You Searched For: 1,3-Diiodopropane

Description: Anti-Dectin-1 Rabbit Monoclonal Antibody [clone: EPR28032-27]

Catalog Number: ABCA_AB311845-1ML

Supplier: Abcam

New Product Sale

Description: Heat Shock Protein BAP1 (heat shock 27-kDa-associated protein 1, or HSPBAP1) inhibits the function of heat shock protein 27, which has a neuroprotective effect during experimentally induced epileptic neuropathology. The HSPBAP1 protein, also known as PASS1, contains a jmjC motif, suggesting it is a member of the jumonji family of transcription factors. There is evidence of domain swapping within the jumonji family genes, and the HSPBAP1 gene has been shown to fuse with a novel gene called DIRC3 in hereditary renal cell cancer.

Catalog Number: 10459-112

Supplier: Bioss

Sale

Description: Calcium dye

Catalog Number: 89165-940

Supplier: Enzo Life Sciences

Sale

Description: PE anti-mouse CD49e [5H10-27(MFR5)]; Isotype: Rat IgG2a, κ; Reactivity: Mouse; Apps: FC; Size: 50 μg

Catalog Number: CA103805-BL

Supplier: Biolegend

Sale

Description: [Spectrophotometric reagent for alkaline earth metals and indicator for the precipitation titration of SO4 with Ba]
CAS Number: 68504-35-8
MDL Number: MFCD00003942
Molecular Formula: C22H16N4O14S4
Molecular Weight: 776.55
Purity/Analysis Method: >90.0% (HPLC)
Form: Crystal

Catalog Number: TCA5010-005G

Supplier: TCI America

SDS Certificates Sale

Description: Spectrophotometric reagent for alkaline earth metals and indicator for sulfate titrations

Catalog Number: CAAAA10486-06

Supplier: Thermo Scientific Chemicals

Certificates Sale

Description: IL-27 is expressed in activated antigen presenting cells including monocytes, endothelial cells, and dendritic cells, for example mouse CD4 splenocytes. This purified antibody has been tested for use in western blotting.

Catalog Number: RL210-403-B54

Supplier: Rockland Immunochemical

Sale

Description: 2-(4-Fluorophenyl)benzimidazole, 95%

Catalog Number: AAH64531-03

Supplier: Thermo Scientific Chemicals

SDS Certificates Sale

Description: Anti-BACE1 Rabbit Monoclonal Antibody [clone: 27] (PE)

Catalog Number: ABCA_AB275651-100T

Supplier: Abcam

New Product Sale

Description: MDL: MFCD00149588 Beilstein Registry No.: 4100175

Catalog Number: CAAAA10927-14

Supplier: Thermo Scientific Chemicals

Certificates Sale

Description: Purified anti-human IL-1β [H1b-27]; Isotype: Mouse IgG2b, κ; Reactivity: Human; Apps: ELISA Capture; Size: 500 μg

Catalog Number: CA511601-BL

Supplier: Biolegend

Sale

Description: Tube clamp is molded of strong, durable plastic with serrated jaws 2.7 cm (1¹⁄₁₆") long.

Catalog Number: 70690-116

Supplier: Bel-Art Products, a Part of SP

Sale

Description: Anti-H2-D1 Mouse Monoclonal Antibody [clone: [27-11-13S]]

Catalog Number: 77122-376

Supplier: Prosci

Sale

Description: 1,3-Benzenediboronic Acid Bis(pinacol) Ester, Purity: >98%(GC), CAS: 196212-27-8, MF: C18H28B2O4, MW: 330.04, Synonyms: 1,3-Bis(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)benzene, 1,3-Phenylenebis(4,4,5,5-tetramethyl-1,3,2-dioxaborolane), Size: 1G

Catalog Number: 76218-808

Supplier: TCI America

Sale

Description: This peptide is a potent antagonist of PACAP 38 and is much more potent and selective than PACAP (6-27) in the inhibition of PACAP-27 stimulated pituitary adenylate cyclase. The Ki values for the inhibition of the enzyme are 7nM and 150 nM, respectively.
Sequence: FTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK-NH2
MW: 4024.8 Da
% Peak area by HPLC: 95
Storage condition: -20° C

Catalog Number: 102996-260

Supplier: Anaspec Inc

Sale

Description: Anti-Fas Ligand Rabbit Monoclonal Antibody [clone: EPR25843-27]

Catalog Number: ABCA_AB300690-1MG

Supplier: Abcam

New Product Sale