You Searched For: Biotin-PEG2-NHS


18,957  results were found

SearchResultCount:"18957"

Sort Results

List View Easy View

Rate These Search Results

Catalog Number: (CA11029-086)
Supplier: Rockland Immunochemical
Description: Anti-Elastase (Rabbit) Antibody Biotin Conjugated - Anti-Elastase Antibody Has Been Assayed Against 1 Ug Of Elastase In A Standard Capture ELISA Using Peroxidase Conjugated Streptavidin And Abts As A Substrate For 30 Minutes At Room Temperature.


Catalog Number: (CA11029-172)
Supplier: Rockland Immunochemical
Description: Anti-Rfp (Chicken) Biotin Conjugated Antibody Is Designed To Detect Recombinant Rfp And Can Be Used To Detect Rfp By ELISA For The Direct Binding Of Antigen. For Immunoblotting Use Alkaline Phosphatase Or Peroxidase Conjugated Polyclonal Anti-Rfp To Rfp.


Catalog Number: (CA11029-280)
Supplier: Rockland Immunochemical
Description: Anti-Alkaline Phosphatase (Calf Intestine) (Rabbit) Antibody Biotin Conjugated - This Product Has Been Assayed Against 1Ug Of Alkaline Phosphatase In A Standard Capture ELISA Using Peroxidase Conjugated Streptavidin And Abts As A Substrate For 30 Minutes


Catalog Number: (89493-668)
Supplier: Genscript
Description: GenScript THE™ His Tag antibody [Biotin], mAb, Mouse specificly recognizes C-terminal, N-terminal and internal His tagged fusion proteins.


Catalog Number: (CA11028-880)
Supplier: Rockland Immunochemical
Description: Anti-Carboxypeptidase Y (Rabbit) Antibody Biotin Conjugated Has Been Assayed Against 1.0 Ug Of Carboxypeptidase Y In A Standard Capture Elisa Using Peroxidase Conjugated Streptavidin And Abts As A Substrate For 30 Minutes At Room Temperature.


Catalog Number: (103007-614)
Supplier: Anaspec Inc
Description: This is amino acids 1 to 40 fragment of mouse and rat beta-amyloid differing from human beta-amyloid by three amino acid residues: Gly5, Phe10, and Arg13. This peptide is biotinylated at the C-terminus.
Sequence: DAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGVV-K(Biotin)-NH2
Molecular Weight: 4587.3 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C


Catalog Number: (103318-974)
Supplier: Novus Biologicals
Description: The Neuropilin-1 Antibody (211H6.01) [Biotin] from Novus Biologicals is a mouse monoclonal antibody to Neuropilin-1. This antibody reacts with human, canine. The Neuropilin-1 Antibody (211H6.01) [Biotin] has been validated for the following applications: Flow Cytometry, Immunohistochemistry, Immunoprecipitation, Immunohistochemistry-Frozen.


Catalog Number: (103359-572)
Supplier: Novus Biologicals
Description: The TRAIL / TNFSF10 Antibody (55B709.3) [Biotin] from Novus Biologicals is a mouse monoclonal antibody to TRAIL / TNFSF10. This antibody reacts with human. The TRAIL / TNFSF10 Antibody (55B709.3) [Biotin] has been validated for the following applications: Western Blot, Immunohistochemistry-Paraffin.


Catalog Number: (CA11029-204)
Supplier: Rockland Immunochemical
Description: Anti-Dextranase (Penicillium Species) (Rabbit) Antibody Biotin Conjugated Has Been Assayed Against 1 Ug Of Dextranase In A Standard Capture ELISA Using Peroxidase Conjugated Streptavidin And Abts As A Substrate For 30 Minutes At Room Temperature.


Catalog Number: (CA11029-178)
Supplier: Rockland Immunochemical
Description: Anti-Glucoamylase (Goat) Antibody Biotin Conjugated - Anti-Glucoamylase Has Been Assayed Against 1.0Ug Of Glucoamylase In A Standard Capture ELISA Using Peroxidase Conjugated Streptavidin And Abts As A Substrate For 30 Minutes At Room Temperature.


Catalog Number: (103359-600)
Supplier: Novus Biologicals
Description: The DNMT1 Antibody (60B1220.1) [Biotin] from Novus Biologicals is a mouse monoclonal antibody to DNMT1. This antibody reacts with human, mouse, rat, porcine. The DNMT1 Antibody (60B1220.1) [Biotin] has been validated for the following applications: Western Blot, Immunocytochemistry / Immunofluorescence, Immunohistochemistry-Paraffin, Immunohistochemistry-Frozen.


Catalog Number: (89262-108)
Supplier: Genetex
Description: Mouse Monoclonal antibody to Mouse IgG2b isotype control Conjugation: Biotin Tested Applications: ELISA FACS Pkg Size: 100 ug


Catalog Number: (CA11028-900)
Supplier: Rockland Immunochemical
Description: Anti-Lactoperoxidase (Bovine Milk) (Sheep) Antibody Biotin - Anti-Lactoperoxidase Antibody Has Been Assayed Against 1Ug Of Lactoperoxidase In A Standard Capture Elisa Using Peroxidase Conjugated Streptavidin And Abts As A Substrate For 30 Minutes At Room Temperature.


Catalog Number: (CA11029-058)
Supplier: Rockland Immunochemical
Description: Anti-Alcohol Dehydrogenase (Yeast) (Rabbit) Antibody Biotin Conjugated-Anti-Alcohol Dehydrogenase Has Been Assayed Against 1Ug Of Alcohol Dehydrogenase In A Standard Capture ELISA Using Peroxidase Conjugated Streptavidin And Abts As A Substrate For 30 Minutes


Catalog Number: (103295-102)
Supplier: Novus Biologicals
Description: The TMIGD2 Antibody (953730) [Biotin] from Novus Biologicals is a mouse monoclonal antibody to TMIGD2. This antibody reacts with human. The TMIGD2 Antibody (953730) [Biotin] has been validated for the following applications: Western Blot, Flow Cytometry.


Catalog Number: (CA11029-328)
Supplier: Rockland Immunochemical
Description: Anti-Trypsin Inhibitor (Rabbit) Antibody Biotin Conjugated - Anti-Trypsin Inhibitor Antibody Is Suitable For Western Blotting And For Capture ELISA. Researchers Should Determine Optimal Titers For Applications That Are Not Stated Below.


Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
You must log in to order restricted items. We request that you provide the required business documentation to purchase this product for the first time.

To order chemicals, medical devices, or other restricted products please provide identification that includes your business name and shipping address via email CMD_NA@vwr.com or fax 484.881.5997 referencing your VWR account number . Acceptable forms of identification are:

  • issued document with your organization's Federal Tax ID Number
  • Government issued document with your organization's Resale Tax ID Number
  • Any other Government ID that includes the business name and address


VWR will not lift restrictions for residential shipping addresses.

-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is currently unavailable but limited stock may be available in our extended warehouse network. Please call 1-800-932-5000 and a VWR Customer Service Representative will help you.
1,105 - 1,120 of 18,957
no targeter for Bottom