You Searched For: Biotin+PEG+4+alkyne


18,148  results were found

SearchResultCount:"18148"

Sort Results

List View Easy View

Rate These Search Results

Catalog Number: (CA11029-030)
Supplier: Rockland Immunochemical
Description: Anti-Fructose-6-Phosphate Kinase (Rabbit Muscle) (Goat) Antibody Biotin Conjugated - Anti-Fructose-6-Phosphate Kinase Antibody Has Been Tested For Use In ELISA, Immunofluorescence Microscopy And Western Blot.


Catalog Number: (CA11029-182)
Supplier: Rockland Immunochemical
Description: Anti-Beta-Phosphoglucomutase (Goat) Antibody Biotin Conjugated-Anti-Beta-Phosphoglucomutase Has Been Assayed Against 1Ug Of Beta-Phosphoglucomutase In A Standard Capture ELISA Using Peroxidase Conjugated Streptavidin.


Catalog Number: (103290-132)
Supplier: Novus Biologicals
Description: The Apolipoprotein A-I / ApoA1 Antibody (2083D) [Biotin] from Novus Biologicals is a rabbit monoclonal antibody to Apolipoprotein A-I / ApoA1. This antibody reacts with human. The Apolipoprotein A-I / ApoA1 Antibody (2083D) [Biotin] has been validated for the following applications: Western Blot.


Catalog Number: (103318-932)
Supplier: Novus Biologicals
Description: The BST2 Antibody (120G8.04) [Biotin] from Novus Biologicals is a rat monoclonal antibody to BST2. This antibody reacts with mouse. The BST2 Antibody (120G8.04) [Biotin] has been validated for the following applications: Flow Cytometry, Immunohistochemistry, Immunohistochemistry-Frozen.


Catalog Number: (103318-910)
Supplier: Novus Biologicals
Description: The Langerin / CD207 Antibody (205C1) [Biotin] from Novus Biologicals is a mouse monoclonal antibody to Langerin / CD207. This antibody reacts with mouse. The Langerin / CD207 Antibody (205C1) [Biotin] has been validated for the following applications: Flow Cytometry.


Catalog Number: (103294-240)
Supplier: Novus Biologicals
Description: The SEC13 Antibody (1280B) [Biotin] from Novus Biologicals is a rabbit monoclonal antibody to SEC13. This antibody reacts with human, mouse, rat. The SEC13 Antibody (1280B) [Biotin] has been validated for the following applications: Western Blot.


Catalog Number: (103008-388)
Supplier: Anaspec Inc
Description: This peptide is Histone H3 (21-44) with an additional C-terminal glycine followed by a biotinylated lysine. Provided at >95% peptide purity, this peptide was dissolved in distilled water at 1 mg/ml and re-lyophilized to powder form.
Sequence:ATKAARKSAPSTGGVKKPHRYRPG-GK(Biotin)-NH2
MW:2932.5 Da
% peak area by HPLC:95
Storage condition:-20° C


Catalog Number: (89262-126)
Supplier: Genetex
Description: Rat Monoclonal antibody to Rat IgG2b isotype control Conjugation: Biotin Tested Applications: ELISA FACS Pkg Size: 100 ug


Catalog Number: (CA11029-096)
Supplier: Rockland Immunochemical
Description: Anti-Trypsin Inhibitor (Rabbit) Antibody Biotin Conjugated - Anti-Trypsin Inhibitor Antibody Is Suitable For Western Blotting And For Capture ELISA. Researchers Should Determine Optimal Titers For Applications That Are Not Stated Below.


Catalog Number: (103292-580)
Supplier: Novus Biologicals
Description: The Lactate Dehydrogenase A / LDHA Antibody (2066A) [Biotin] from Novus Biologicals is a rabbit monoclonal antibody to Lactate Dehydrogenase A / LDHA. This antibody reacts with human. The Lactate Dehydrogenase A / LDHA Antibody (2066A) [Biotin] has been validated for the following applications: Western Blot, Flow Cytometry.


Catalog Number: (89493-668)
Supplier: Genscript
Description: GenScript THE™ His Tag antibody [Biotin], mAb, Mouse specificly recognizes C-terminal, N-terminal and internal His tagged fusion proteins.


Catalog Number: (CA11028-880)
Supplier: Rockland Immunochemical
Description: Anti-Carboxypeptidase Y (Rabbit) Antibody Biotin Conjugated Has Been Assayed Against 1.0 Ug Of Carboxypeptidase Y In A Standard Capture Elisa Using Peroxidase Conjugated Streptavidin And Abts As A Substrate For 30 Minutes At Room Temperature.


Catalog Number: (103007-614)
Supplier: Anaspec Inc
Description: This is amino acids 1 to 40 fragment of mouse and rat beta-amyloid differing from human beta-amyloid by three amino acid residues: Gly5, Phe10, and Arg13. This peptide is biotinylated at the C-terminus.
Sequence: DAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGVV-K(Biotin)-NH2
Molecular Weight: 4587.3 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C


Catalog Number: (103318-666)
Supplier: Novus Biologicals
Description: The Basophils Antibody (212H6.16) [Biotin] from Novus Biologicals is a mouse monoclonal antibody to Basophils. This antibody reacts with human, canine. The Basophils Antibody (212H6.16) [Biotin] has been validated for the following applications: Flow Cytometry, Immunohistochemistry, Immunohistochemistry-Frozen.


Catalog Number: (103318-974)
Supplier: Novus Biologicals
Description: The Neuropilin-1 Antibody (211H6.01) [Biotin] from Novus Biologicals is a mouse monoclonal antibody to Neuropilin-1. This antibody reacts with human, canine. The Neuropilin-1 Antibody (211H6.01) [Biotin] has been validated for the following applications: Flow Cytometry, Immunohistochemistry, Immunoprecipitation, Immunohistochemistry-Frozen.


Catalog Number: (103359-572)
Supplier: Novus Biologicals
Description: The TRAIL / TNFSF10 Antibody (55B709.3) [Biotin] from Novus Biologicals is a mouse monoclonal antibody to TRAIL / TNFSF10. This antibody reacts with human. The TRAIL / TNFSF10 Antibody (55B709.3) [Biotin] has been validated for the following applications: Western Blot, Immunohistochemistry-Paraffin.


Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
You must log in to order restricted items. We request that you provide the required business documentation to purchase this product for the first time.

To order chemicals, medical devices, or other restricted products please provide identification that includes your business name and shipping address via email CMD_NA@vwr.com or fax 484.881.5997 referencing your VWR account number . Acceptable forms of identification are:

  • issued document with your organization's Federal Tax ID Number
  • Government issued document with your organization's Resale Tax ID Number
  • Any other Government ID that includes the business name and address


VWR will not lift restrictions for residential shipping addresses.

-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is currently unavailable but limited stock may be available in our extended warehouse network. Please call 1-800-932-5000 and a VWR Customer Service Representative will help you.
657 - 672 of 18,148
no targeter for Bottom