You Searched For: Biotin+PEG+4+alkyne


30,578  results were found

Sort Results

List View Easy View
SearchResultCount:"30578"
Description: Biotin-Amylin (1-37), human, amide, Purity: Greater than or equal to 95% (HPLC), Molecular weight: 4129.7, Sequence: Biotin-KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTY-NH2 (disulfide bridge: 2-7), amidated amylin (1-37) peptide (N-terminus), Storage: -20 degree C, Size: 0.5mg
Catalog Number: 103008-174
Supplier: Anaspec Inc


Description: Biotin-20-dUTP (40030) is in a lyophilized powder form that is suitable for long term storage.
Catalog Number: 89139-096
Supplier: Biotium


Description: Trueblot Biotin magnetic beads, Conjugate: Biotin, Buffer: 0.15M Tris, 0.15M NaCl, 0.001M EDTA, pH7.4, Synonyms: Magnetic beads, particles, microparticles, paramagnetic nanoparticles, magnets, protein antibody, DNA, bio
Catalog Number: 76226-088
Supplier: Rockland Immunochemical


Description: Biotin-LC-LL-37, Sequence: Biotin-LC-LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES, Purity: By HPLC >/= 95%, Molecular Weight: 4832.8, Apperance: Lyophilized white powder, Peptide Reconstitution: Biotin - LC - LL - 37 is freely soluble in water, Storage: -20 C, Size: 0.5 mg
Catalog Number: 103007-674
Supplier: Anaspec Inc


Description: Polyclonal, Host: Rabbit, Label: Fluorescein (FITC), Immunogen: Biotin conjugated Keyhole Limpet Hemocyanin (KLH), Synonym: FITC, Biotin Fluorescein, Anti-Biotin FITC Antibody, Application: IF Microscopy, FlowCytometry, format: IgG, 25ul.
Catalog Number: CA200-4298S
Supplier: Rockland Immunochemical


Description: Biotin-11-dUTP (40029) is in a lyophilized powder form that is suitable for long term storage.
Catalog Number: 89139-092
Supplier: Biotium


Description: Digoxigenin Biotin Monoclonal Antibody (Clone 611621), Mouse IgG2A, IHC, Species Reactivity:Multi-species, Label:Biotin, Immunogen:KLH-coupled Digoxigenin
Catalog Number: 102879-148
Supplier: R&D Systems


Description: Biotin - Corticotropin Releasing Factor, Biotin - CRF, human, rat, Sequence: Biotin - SEEPPISLDLTFHLLREVLEMARAEQLAQQAHSNRKLMEII - NH2, Purity: HPLC greater than or equal to 95%, Molecular Weight: 4984.8, Apperance: Solid, Storage: -20 C, Size: 0.5 mg
Catalog Number: 102999-772
Supplier: Anaspec Inc


Description: Chicken OVA (323-339),Biotin
Catalog Number: 103008-440
Supplier: Anaspec Inc


Description: Anti-SH3BP1 Rabbit Polyclonal Antibody (Biotin)
Catalog Number: 77714-468
Supplier: AFG Bioscience

New Product


Description: Anti-RASL10B Rabbit Polyclonal Antibody (Biotin)
Catalog Number: 77722-934
Supplier: AFG Bioscience

New Product


Description: Anti-choD Rabbit Polyclonal Antibody (Biotin)
Catalog Number: 77712-231
Supplier: AFG Bioscience

New Product


Description: Anti-Havcr1 Rabbit Polyclonal Antibody (Biotin)
Catalog Number: 77711-520
Supplier: AFG Bioscience

New Product


Description: Anti-KIAA0319 Rabbit Polyclonal Antibody (Biotin)
Catalog Number: 77714-198
Supplier: AFG Bioscience

New Product


Description: Anti-PIGS Rabbit Polyclonal Antibody (Biotin)
Catalog Number: 77724-031
Supplier: AFG Bioscience

New Product


Description: Anti-MT1F Rabbit Polyclonal Antibody (Biotin)
Catalog Number: 77711-714
Supplier: AFG Bioscience

New Product


225 - 240 of 30,578