Print…

You Searched For: Transport+Swabs


0  results were found

Refine Results Sort by

Sort Results

List View Easy View
SearchResultCount:"0"

Rate These Search Results

Image Unavailable-77674-736

Foalwatch (Calcium) Test Kit, CHEMetrics

Description: The FoalWatch system is based on proven chemistry, so you can rest easier at night. The test measures the concentration of calcium in the, colostrum. The calcium level rises sharply before birth. Simply begin testing once or twice a day about 2 weeks before the mareís expected foaling date. When the calcium concentration consistently exceeds 200 parts per million (ppm), birth is imminent.FoalWatch Kit contains everything you need for testing.
Catalog Number: 77674-736
Supplier: CHEMetrics

New Product


Product Image-76714-110

Human S100 Calcium Binding Protein A15 (S100A15) ELISA Kit

Description: Human S100 Calcium Binding Protein A15 (S100A15) ELISA Kit
Catalog Number: 76714-110
Supplier: AFG Bioscience
Product Image-76715-178

Human S100 Calcium Binding Protein A14 (S100A14) ELISA Kit

Description: Human S100 Calcium Binding Protein A14 (S100A14) ELISA Kit
Catalog Number: 76715-178
Supplier: AFG Bioscience
Image Unavailable-89139-296

Buffer Kit for Calibration of Fluorescent Ca² Indicators, Biotium

Description: Kit provides a range of calibration buffers with accurate calcium concentrations and is useful for the calibration of fluorescent Ca² indicators (1,2).
Catalog Number: 89139-296
Supplier: Biotium
Product Image-76705-964

Human S100 Calcium Binding Protein P (S100P) ELISA Kit

Description: Human S100 Calcium Binding Protein P (S100P) ELISA Kit
Catalog Number: 76705-964
Supplier: AFG Bioscience
Product Image-76714-144

Human Calcium Dependent Phospholipase A2 (PLA2G5) ELISA Kit

Description: Human Calcium Dependent Phospholipase A2 (PLA2G5) ELISA Kit
Catalog Number: 76714-144
Supplier: AFG Bioscience
Product Image-76711-978

Human Calcium/Calmodulin-Dependent Protein Kinase type II Subunit beta (CAMK2B) ELISA Kit

Description: Human Calcium/Calmodulin-Dependent Protein Kinase type II Subunit beta (CAMK2B) ELISA Kit
Catalog Number: 76711-978
Supplier: AFG Bioscience
Product Image-470232-968

Wallcur® PRACTI-Oral Medication for Training Purposes

Description: Prelabeled and packaged.
Catalog Number: 470232-968
Supplier: WALLCUR, LLC.
Product Image-76715-604

Human Calcium/Calmodulin-Dependent Protein Kinase-2 (CAMK 2) ELISA Kit

Description: Human Calcium/Calmodulin-Dependent Protein Kinase-2 (CAMK 2) ELISA Kit
Catalog Number: 76715-604
Supplier: AFG Bioscience
Product Image-470300-642

Calcium Sulfate Hemihydrate

Description: CAS Number: 26499-65-0
Formula Weight: 145.15
Formula: CaSO4·12H2O
Density (g/mL): 2.8
Solubility: Water
Synonyms: Plaster of Paris, Dried Gypsum
Shelf Life (months): 36
Storage: Green
Catalog Number: 470300-642
Supplier: Ward's Science

SDS


Image Unavailable-10665-618

Anti-SERPINH1 Rabbit Polyclonal Antibody

Description: Members of the EF-CBP (N-terminal EF-hand calcium binding protein)/NECAB (neuronal calcium-binding protein) family participate in neuronal calcium signaling. EF-CBP2, also known as NECAB2 (N-terminal EF-hand calcium binding protein 2), neuronal calcium-binding protein 2 or synaptotagmin-interacting protein 2 (Stip-2), is a 386 amino acid cytoplasmic protein that contains one antibiotic biosynthesis monooxygenase (ABM) domain and two EF-hand domains. Expressed in brain, EF-CBP2 is suggested to bind metabotropic glutamate receptor 5 (mGluR-5) in a calcium-regulated manner. The gene encoding EF-CBP2 maps to human chromosome 16, which encodes over 900 genes and comprises nearly 3% of the human genome. The rare disorder Rubinstein-Taybi syndrome is also associated with chromosome 16, as is Crohn's disease, which is a gastrointestinal inflammatory condition.
Catalog Number: 10665-618
Supplier: Bioss
Product Image-10099-794

Anti-SLC8B1 Rabbit Polyclonal Antibody

Description: SLC24A6 belongs to a family of potassium-dependent sodium/calcium exchangers that maintain cellular calcium homeostasis through the electrogenic countertransport of 4 sodium ions for 1 calcium ion and 1 potassium ion.SLC24A6 belongs to a family of potassium-dependent sodium/calcium exchangers that maintain cellular calcium homeostasis through the electrogenic countertransport of 4 sodium ions for 1 calcium ion and 1 potassium ion (Cai and Lytton, 2004 [PubMed 14625281]).
Catalog Number: 10099-794
Supplier: Prosci
Product Image-10749-012

Anti-CACNA1H Rabbit Polyclonal Antibody

Description: The calcium channel protein CACNA1H is a T-type member of the alpha-1 subunit family that is part of the voltage-dependent calcium channel complex which mediates the influx of calcium ions into the cell upon membrane polarization. CACNA1H is a subunit of Cav3.2 T-type calcium channel that is involved in neurological disorders such as epilepsy and pain. CACNA1H associates with the caveolin protein Cav-3 and it is thought that Cav-3 regulates the Protein Kinase A (PKA) modulation of CACNA1H-containing Cav3.2 T-type calcium channels.
Catalog Number: 10749-012
Supplier: Prosci
Product Image-10808-128

Puritan® Calgiswab® Calcium Alginate-Tipped Applicators, Plastic Shaft, Sterile, Puritan Medical Products

Description: General all purpose swabs for wound care
Catalog Number: 10808-128
Supplier: Puritan Medical Products
Image Unavailable-103008-282

Ryanodine receptor 1 Peptide

Description: This peptide is amino acids 3614 to 3643 fragment of Ryanodine receptor 1 (RyR1), also known as calmodulin binding peptide (CaMBP), belonging to a class of intracellular calcium channels. It is the major cellular mediator of calcium-induced calcium release (CICR) in animal cells. The ryanodine receptor is itself activated by cytosolic calcium.
Sequence:KSKKAVWHKLLSKQRRRAVVACFRMTPLYN
MW:3616.4 Da
% peak area by HPLC:95
Storage condition:-20° C
Catalog Number: 103008-282
Supplier: Anaspec Inc
Product Image-10099-624

Anti-CACNB3 Rabbit Polyclonal Antibody

Description: The L-type calcium channel is composed of four subunits: alpha-1, alpha-2, beta and gamma. The beta subunit of voltage-dependent calcium channels contributes to the function of the calcium channel by increasing peak calcium current, shifting the voltage dependencies of activation and inactivation, modulating G protein inhibition and controlling the alpha-1 subunit membrane targeting.
Catalog Number: 10099-624
Supplier: Prosci
225 - 0 of 0