Print…

You Searched For: Ethyl acetate


5,655  results were found

Refine Results Sort by

Sort Results

List View Easy View
SearchResultCount:"5655"

Rate These Search Results

Image Unavailable-10229-008

Anti-ADM Rabbit Polyclonal Antibody (Cy5®)

Description: AM and PAMP are potent hypotensive and vasodilatator agents. Numerous actions have been reported most related to the physiologic control of fluid and electrolyte homeostasis. In the kidney, am is diuretic and natriuretic, and both am and pamp inhibit aldosterone secretion by direct adrenal actions. In pituitary gland, both peptides at physiologically relevant doses inhibit basal ACTH secretion. Both peptides appear to act in brain and pituitary gland to facilitate the loss of plasma volume, actions which complement their hypotensive effects in blood vessels.
Catalog Number: 10229-008
Supplier: Bioss
Image Unavailable-10229-006

Anti-ADM Rabbit Polyclonal Antibody (Cy3®)

Description: AM and PAMP are potent hypotensive and vasodilatator agents. Numerous actions have been reported most related to the physiologic control of fluid and electrolyte homeostasis. In the kidney, am is diuretic and natriuretic, and both am and pamp inhibit aldosterone secretion by direct adrenal actions. In pituitary gland, both peptides at physiologically relevant doses inhibit basal ACTH secretion. Both peptides appear to act in brain and pituitary gland to facilitate the loss of plasma volume, actions which complement their hypotensive effects in blood vessels.
Catalog Number: 10229-006
Supplier: Bioss
Image Unavailable-103003-156

Human Adrenomedullin (22-52)

Description: AM (22-52) is known as an adrenomedullin receptor antagonist and a cardiac depressant factor, although there is some discrepancy in the literature regarding the selectivity of ADM 22-52 as adrenomedullin receptor antagonist.
Sequence:TVQKLAHQIYQFTDKDKDNVAPRSKISPQGY-NH2
MW:3576 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C
Catalog Number: 103003-156
Supplier: Anaspec Inc
Product Image-77461-886

Violet 660 sodium salt, CytoCalcein™ excited at 405 nm

Description: CytoCalcein™ Violet 660 is the esterase-cleaved product of CytoCalcein™ Violet 660 AM in live cells.
Catalog Number: 77461-886
Supplier: AAT BIOQUEST INC
Product Image-76493-214

Primaide™ HPLC System, Hitachi

Description: The Primaide™ is a standard HPLC system designed and manufactured to the highest quality by Hitachi. Suitable for academic and other small laboratories that need a sturdy and reliable standard HPLC system.
Catalog Number: 76493-214
Supplier: HITACHI HIGH-TECH AMERICA, INC.
Image Unavailable-ABCA_AB279733-1X96

Phospho-AMPK alpha 1 (S487) ELISA Kit

Description: Phospho-AMPK alpha 1 (S487) ELISA Kit
Catalog Number: ABCA_AB279733-1X96
Supplier: Abcam

New Product


Image Unavailable-H-3192.0005BA

(d(CH₂)₅¹,D-Tyr(Et)²,Val⁴,Arg⁸,des-Gly⁹)-Vasopressin

Description: For desmopressin see H-7675.
Catalog Number: H-3192.0005BA
Supplier: Bachem Americas
Product Image-76710-918

Human Aspartate Aminotransferase(GOT/GPT) ELISA Kit

Description: Human Aspartate Aminotransferase(GOT/GPT) ELISA Kit
Catalog Number: 76710-918
Supplier: AFG Bioscience
Product Image-76707-328

Mouse Aspartate Aminotransferase, Cytoplasmic(GOT1) ELISA Kit

Description: Mouse Aspartate Aminotransferase, Cytoplasmic(GOT1) ELISA Kit
Catalog Number: 76707-328
Supplier: AFG Bioscience
Image Unavailable-77528-876

Durx® 670 AS (Aerospace) Non-woven Cleanroom Wiper, 55% Cellulose/45% Polyester

Description: Durx® 670 AS for Aerospace (AS) is a hydroentangled, non-woven blend of 55% cellulose and 45% polyester with no binders or other chemical additives. This wiper meets the AMS 3819D, Class 2, Grade A, Form 1 requirements.
Catalog Number: 77528-876
Supplier: Berkshire
Product Image-94001-082

Tile-Top AM Anti-Fatigue Mat with Anti-Microbial Sponge, Wearwell®

Description: Combats fatigue while providing a top to bottom anti-microbial solution.
Catalog Number: 94001-082
Supplier: Wearwell
Product Image-470179-516

Ward's® Live Escherichia coli Conjugation Strains

Description: Two strains of Escherichia coli (donor and host) with complementary sensitivities to Ampicillin and Streptomycin. Watch them trade traits via conjugation.
Catalog Number: 470179-516
Supplier: Avantor
Product Image-76644-598

X-Plore® 8000 PAPR Sets

Description: An assortment of hood/helmet PAPR kits.
Catalog Number: 76644-598
Supplier: Draeger

Environmentally Preferable


Image Unavailable-H-2932.1000BA

Human Adrenomedullin Trifluoroacetate

Description: Adrenomedullin (ADM) elicits a potent and longlasting hypotensive effect and is considered as a hormone involved in blood pressure control. Additionally, ADM acts as a protective factor of blood vessels. Adrenomedullin is a potent stimulator of osteoblastic activity. Further biological activities of hADM include reduction of oxidative stress and inhibition of endothelial cell apoptosis.
Catalog Number: H-2932.1000BA
Supplier: Bachem Americas
Image Unavailable-470110-888

The WeatherCycler Complete Teaching Unit

Description: The WeatherCycler Complete Teaching Unit
Catalog Number: 470110-888
Supplier: AMS PROJECT ATMOSPHERE
Image Unavailable-CAAAJ62837-LB0

Staurosporine ≥99%

Description: Broad spectrum protein kinase inhibitor
Catalog Number: CAAAJ62837-LB0
Supplier: Thermo Scientific Chemicals

Certificates


1 - 16 of 5,655