You Searched For: Antistatic+Treatments


2,238  results were found

SearchResultCount:"2238"

Sort Results

List View Easy View

Rate These Search Results

Catalog Number: (77007-612)
Supplier: Genscript
Description: Dupilumab with trade name dupixent, is an FDA-approved drug for the treatment of patients aged six years and older with moderate-to-severe atopic dermatitis. It is a human monoclonal antibody. Dupilumab binds to the interleukin-4 receptor alpha (IL-4R alpha) subunit shared by the interleukin (IL)-4 and IL-13 receptor complexes, thereby inhibiting IL-4 and IL-13 signaling. Anti-Dupilumab Antibody (6C9), mAb, Mouse is produced from a hybridoma resulting from the fusion of partner and B-lymphocytes obtained from a mouse immunized with dupilumab.


Supplier: ELGA LabWater
Description: The award winning PURELAB flex range is designed around your needs, delivering accuracy, flexibility and ease of use with an innovative and ergonomic design

Catalog Number: (10092-094)
Supplier: Proteintech
Description: The suprachiasmatic nuclei (SCN) of the anterior hypothalamus function as a circadian clock in the mammalian brain, generating circadian rhythms in physiology and behavior. The period homolog genesPer3 is an important component of the circadian clock system. PER3 plays a role in cell proliferation, apoptosis,DNA damage response, cell cycle control, and treatment response of chemotherapy agents in cancers.


Supplier: Berkshire
Description: Ideal for absorbing spills of solvents and deionized water in ISO Class 5 (FED-STD-209E Class 100/M3.5) environments.

Small Business Enterprise

Catalog Number: (103010-552)
Supplier: Anaspec Inc
Description: The renin–angiotensin system (RAS) plays a central role in the regulation of blood pressure and electrolyte homoeostasis. An overactive renin-angiotensin system leads to hypertension. As a result, renin is an attractive target for the treatment of this disease

Recombinant mouse prorenin is produced in HEK cells and purified by chelated metal affinity chromatography. It contains an 8x-Histidine tag at the C terminus. The apparent Mr of recombinant enzyme on SDS-PAGE is 41.7 kDa. Prorenin, the precursor of renin, is a glycosylated aspartic protease that consists of 2 homologous lobes. Prorenin can be activated with trypsin. Its activity can be measured in a FRET-based enzymatic assay


Catalog Number: (103006-562)
Supplier: Anaspec Inc
Description: This 37 residue peptide is a very effective antimicrobial agent in rabbits. The CAP-18 cathelicidin-derived peptide kills bacteria by disrupting the bacterial membrane. It has a potential for the treatment of bacterial infections in normal and immunocompromised persons and individuals with cystic fibrosis. In experiments it demonstrates the greatest activity against over 20 clinical strains of Pseudomonas aeruginosa. Homologs of CAP18 in other species include humans (FALL39/LL37), mice (mCRAMP), rats (rCRAMP), and sheep (SMAP29 and SMAP34).
Sequence:GLRKRLRKFRNKIKEKLKKIGQKIQGLLPKLAPRTDY
MW:4433.5 Da
% peak area by HPLC:95
Storage condition:-20° C


Catalog Number: (76121-298)
Supplier: Bioss
Description: Estradiol (known as alpha Estradiol or 17 alpha Estradiol) is a biologically active estrogen in human breast cancer cells in tissue culture.17-estradiol and its selective receptor, ER-X, are not part of a classical hormone/receptor endocrine system but of a system with important autocrine/paracrine functions in the developing and adult brain. 17-Estradiol may have enormous implications for hormone replacement strategies at the menopause and in the treatment of such neurodegenerative disorders as Alzheimer's disease and ischemic stroke.


Catalog Number: (75793-138)
Supplier: Prosci
Description: ACRP30 was identified as a novel adipocyte-specific synthesized and secreted protein with structural resemblance to complement factor C1q. Like adipsin, ACRP30 secretion is induced ~10-fold during adipocyte differentiation. Plasma levels are reduced in obese humans, and low levels are associated with insulin-resistance. Treatment of db/db mice with TZD increased ACRP30 levels.


Catalog Number: (10088-842)
Supplier: Proteintech
Description: IL4 is a cytokine produced by CD4+ T cells in response to helminthes and other extracellular parasites. It promotes the proliferation and differentiation of antigen presenting cells. IL4 also plays a pivotal role in antibody isotype switching and stimulates the production of IgE. This cytokine has been applied in the treatment of autoimmune disorder like multiple myeloma, cancer, psoriasis, and arthritis. IL4 has also been extensively applied to inhibit detrimental effect of Th1. It may promote the growth of epithelial tumors by mediating increased proliferation and survival.


Catalog Number: (89416-592)
Supplier: Prosci
Description: UROP11 Antibody: Upregulated obese product 11 (UROP11) was isolated from subtractive library for mouse hypothalamus. It is detected in numerous tissues and is upregulated in the hypothalamus and adipocytes in obese mice. UROP11 is also observed in human neural and lymphoid tissues; its expression appears to be regulated by the level of lymphoid activation. Urop11 expression is strongly upregulated both in vivo in mouse hypothalamus and in vitro in mouse neural cell lines after treatment with leptin, indicating Urop11 is a target of leptin activity and thus may play a role in obesity.


Catalog Number: (76085-034)
Supplier: Bioss
Description: In the presence of inorganic orthophosphate, the platelet-derived endothelial growth factor (PD-ECGF) thymidine phosphorylase (TP) (gliostatin) catalyses the reversible phospholytic cleavage of thymidine and deoxyuridine to their corresponding bases and 2-deoxyribose-1-phosphate. It is both chemotactic and mitogenic for endothelial cells and a non-heparin binding angiogenic factor present in platelets. It is also involved in transformation of fluoropyrimidines, cytotoxic agents used in the treatment of a variety of malignancies, into active cytotoxic metabolites.


Catalog Number: (95030-900)
Supplier: Spectrum Chemicals
Description: Hydrous Benzoyl Peroxide, 75 Percent, USP is used to treat mild to moderate acne. All Spectrum Chemical USP products are manufactured, packaged and stored under current Good Manufacturing Practices (cGMP) per 21CFR part 211 in FDA registered and inspected facilities

Catalog Number: (76121-300)
Supplier: Bioss
Description: Estradiol (known as alpha Estradiol or 17 alpha Estradiol) is a biologically active estrogen in human breast cancer cells in tissue culture.17-estradiol and its selective receptor, ER-X, are not part of a classical hormone/receptor endocrine system but of a system with important autocrine/paracrine functions in the developing and adult brain. 17-Estradiol may have enormous implications for hormone replacement strategies at the menopause and in the treatment of such neurodegenerative disorders as Alzheimer's disease and ischemic stroke.


Catalog Number: (10399-146)
Supplier: Bioss
Description: HCV is a positive, single-stranded RNA virus in the Flaviviridae family. The genome is approximately 10,000 nucleotides and encodes a single polyprotein of about 3,000 amino acids. The polyprotein is processed by host cell and viral proteases into three major structural proteins and several non-structural protein necessary for viral replication. Several different genotypes of HCV with slightly different genomic sequences have since been identified that correlate with differences in response to treatment with interferon alpha.


Catalog Number: (CA89231-266)
Supplier: Hach
Description: Chlorine, Hardness, Iron, and pH Test Kit combines the most popular water treatment test into one compact kit.


Catalog Number: (77007-620)
Supplier: Genscript
Description: Omalizumab with trade name Xolair, is an FDA-approved drug for the treatment of moderate to severe persistent asthma in adults and adolescents (12 years of age and above). It is a recombinant humanized monoclonal antibody. It selectively binds to human immunoglobulin E (IgE). Omalizumab inhibits the binding of IgE to the high-affinity IgE receptor (FcεRI) on the surface of mast cells and basophils. Anti-Omalizumab Antibody (10G3), mAb, Mouse is produced from a hybridoma resulting from the fusion of partner and B-lymphocytes obtained from a mouse immunized with Omalizumab.


Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
You must log in to order restricted items. We request that you provide the required business documentation to purchase this product for the first time.

To order chemicals, medical devices, or other restricted products please provide identification that includes your business name and shipping address via email CMD_NA@vwr.com or fax 484.881.5997 referencing your VWR account number . Acceptable forms of identification are:

  • issued document with your organization's Federal Tax ID Number
  • Government issued document with your organization's Resale Tax ID Number
  • Any other Government ID that includes the business name and address


VWR will not lift restrictions for residential shipping addresses.

-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is currently unavailable but limited stock may be available in our extended warehouse network. Please call 1-800-932-5000 and a VWR Customer Service Representative will help you.
417 - 432 of 2,238
no targeter for Bottom