You Searched For: Antistatic+Treatments


2,238  results were found

SearchResultCount:"2238"

Sort Results

List View Easy View

Rate These Search Results

Catalog Number: (75841-694)
Supplier: BIOGEMS INTERNATIONAL INC.
Description: The G4.18 monoclonal antibody specifically reacts with rat CD3, a T cell lineage marker and associated with the T cell receptor (TCR). CD3 is involved in antigen recognition, cell activation, and signal transduction and is found on subsets of NK-T, peripheral T, dendritic epidermal T, and thymocyte cells. Immobilized G4.18 antibody activates T cells in vitro and in vivo treatments of the G4.18 antibody prevents cardiac and skin allograft rejection.


Catalog Number: (10404-828)
Supplier: Bioss
Description: HCV is a positive, single-stranded RNA virus in the Flaviviridae family. The genome is approximately 10,000 nucleotides and encodes a single polyprotein of about 3,000 amino acids. The polyprotein is processed by host cell and viral proteases into three major structural proteins and several non-structural protein necessary for viral replication. Several different genotypes of HCV with slightly different genomic sequences have since been identified that correlate with differences in response to treatment with interferon alpha.


Catalog Number: (77007-612)
Supplier: Genscript
Description: Dupilumab with trade name dupixent, is an FDA-approved drug for the treatment of patients aged six years and older with moderate-to-severe atopic dermatitis. It is a human monoclonal antibody. Dupilumab binds to the interleukin-4 receptor alpha (IL-4R alpha) subunit shared by the interleukin (IL)-4 and IL-13 receptor complexes, thereby inhibiting IL-4 and IL-13 signaling. Anti-Dupilumab Antibody (6C9), mAb, Mouse is produced from a hybridoma resulting from the fusion of partner and B-lymphocytes obtained from a mouse immunized with dupilumab.


Supplier: Berkshire
Description: Ideal for absorbing spills of solvents and deionized water in ISO Class 5 (FED-STD-209E Class 100/M3.5) environments.

Small Business Enterprise

Catalog Number: (10096-888)
Supplier: Proteintech
Description: USP5, also named as ISOT, belongs to the peptidase C19 family. Knock-down of USP5 causes the accumulation of TP53/p53 and an increase in TP53/p53 transcriptional activity because the unanchored polyubiquitin that accumulates is able to compete with ubiquitinated TP53/p53 but not with MDM2 for proteasomal recognition. USP5 is a potential target for p53 activating therapeutic agents for the treatment of cancer. It is a novel proteasome associated protein. USP5 cleaves linear and branched multiubiquitin polymers with a marked preference for branched polymers.


Catalog Number: (10405-896)
Supplier: Bioss
Description: HCV is a positive, single-stranded RNA virus in the Flaviviridae family. The genome is approximately 10,000 nucleotides and encodes a single polyprotein of about 3,000 amino acids. The polyprotein is processed by host cell and viral proteases into three major structural proteins and several non-structural protein necessary for viral replication. Several different genotypes of HCV with slightly different genomic sequences have since been identified that correlate with differences in response to treatment with interferon alpha.


Catalog Number: (103010-552)
Supplier: Anaspec Inc
Description: The renin–angiotensin system (RAS) plays a central role in the regulation of blood pressure and electrolyte homoeostasis. An overactive renin-angiotensin system leads to hypertension. As a result, renin is an attractive target for the treatment of this disease

Recombinant mouse prorenin is produced in HEK cells and purified by chelated metal affinity chromatography. It contains an 8x-Histidine tag at the C terminus. The apparent Mr of recombinant enzyme on SDS-PAGE is 41.7 kDa. Prorenin, the precursor of renin, is a glycosylated aspartic protease that consists of 2 homologous lobes. Prorenin can be activated with trypsin. Its activity can be measured in a FRET-based enzymatic assay


Catalog Number: (103006-562)
Supplier: Anaspec Inc
Description: This 37 residue peptide is a very effective antimicrobial agent in rabbits. The CAP-18 cathelicidin-derived peptide kills bacteria by disrupting the bacterial membrane. It has a potential for the treatment of bacterial infections in normal and immunocompromised persons and individuals with cystic fibrosis. In experiments it demonstrates the greatest activity against over 20 clinical strains of Pseudomonas aeruginosa. Homologs of CAP18 in other species include humans (FALL39/LL37), mice (mCRAMP), rats (rCRAMP), and sheep (SMAP29 and SMAP34).
Sequence:GLRKRLRKFRNKIKEKLKKIGQKIQGLLPKLAPRTDY
MW:4433.5 Da
% peak area by HPLC:95
Storage condition:-20° C


Catalog Number: (10088-842)
Supplier: Proteintech
Description: IL4 is a cytokine produced by CD4+ T cells in response to helminthes and other extracellular parasites. It promotes the proliferation and differentiation of antigen presenting cells. IL4 also plays a pivotal role in antibody isotype switching and stimulates the production of IgE. This cytokine has been applied in the treatment of autoimmune disorder like multiple myeloma, cancer, psoriasis, and arthritis. IL4 has also been extensively applied to inhibit detrimental effect of Th1. It may promote the growth of epithelial tumors by mediating increased proliferation and survival.


Catalog Number: (89416-592)
Supplier: Prosci
Description: UROP11 Antibody: Upregulated obese product 11 (UROP11) was isolated from subtractive library for mouse hypothalamus. It is detected in numerous tissues and is upregulated in the hypothalamus and adipocytes in obese mice. UROP11 is also observed in human neural and lymphoid tissues; its expression appears to be regulated by the level of lymphoid activation. Urop11 expression is strongly upregulated both in vivo in mouse hypothalamus and in vitro in mouse neural cell lines after treatment with leptin, indicating Urop11 is a target of leptin activity and thus may play a role in obesity.


Catalog Number: (CA76339-832)
Supplier: Corning
Description: Species: Bovine, bos taurus
Type: Fetal
Treatment: Heat inactivated and gamma irradiated
Format: Liquid
Shelf life: 60 months

New Product


Supplier: Puritan Medical Products
Description: For use in cleaning sensitive components

Catalog Number: (89154-392)
Supplier: Enzo Life Sciences
Description: Caspase-11 not only activates caspase-1, that is required for the maturation of proinflammatory cytokines such as interleukin-1 (IL-1) and interleukin-18 (IL-18), but also activates caspase-3, leading to cellular apoptosis under pathological conditions. In most cells, caspase-11 is only expressed upon induction with pro-inflammatory stimuli. Caspase-11 is an essential mediator of endotoxic shock and caspase-11-deficient mice are resistant to endotoxic shock. LPS-induced caspase-11 regulates lymphocyte apoptosis by activating both caspase-3 and caspase-7. Human caspase-4, thought to be the homolog of mouse caspase-11, may be an effective therapeutic target for treatment of septic shock.


Catalog Number: (76085-034)
Supplier: Bioss
Description: In the presence of inorganic orthophosphate, the platelet-derived endothelial growth factor (PD-ECGF) thymidine phosphorylase (TP) (gliostatin) catalyses the reversible phospholytic cleavage of thymidine and deoxyuridine to their corresponding bases and 2-deoxyribose-1-phosphate. It is both chemotactic and mitogenic for endothelial cells and a non-heparin binding angiogenic factor present in platelets. It is also involved in transformation of fluoropyrimidines, cytotoxic agents used in the treatment of a variety of malignancies, into active cytotoxic metabolites.


Catalog Number: (95030-900)
Supplier: Spectrum Chemicals
Description: Hydrous Benzoyl Peroxide, 75 Percent, USP is used to treat mild to moderate acne. All Spectrum Chemical USP products are manufactured, packaged and stored under current Good Manufacturing Practices (cGMP) per 21CFR part 211 in FDA registered and inspected facilities

Catalog Number: (76121-300)
Supplier: Bioss
Description: Estradiol (known as alpha Estradiol or 17 alpha Estradiol) is a biologically active estrogen in human breast cancer cells in tissue culture.17-estradiol and its selective receptor, ER-X, are not part of a classical hormone/receptor endocrine system but of a system with important autocrine/paracrine functions in the developing and adult brain. 17-Estradiol may have enormous implications for hormone replacement strategies at the menopause and in the treatment of such neurodegenerative disorders as Alzheimer's disease and ischemic stroke.


Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
You must log in to order restricted items. We request that you provide the required business documentation to purchase this product for the first time.

To order chemicals, medical devices, or other restricted products please provide identification that includes your business name and shipping address via email CMD_NA@vwr.com or fax 484.881.5997 referencing your VWR account number . Acceptable forms of identification are:

  • issued document with your organization's Federal Tax ID Number
  • Government issued document with your organization's Resale Tax ID Number
  • Any other Government ID that includes the business name and address


VWR will not lift restrictions for residential shipping addresses.

-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is currently unavailable but limited stock may be available in our extended warehouse network. Please call 1-800-932-5000 and a VWR Customer Service Representative will help you.
385 - 400 of 2,238
no targeter for Bottom