Print…

You Searched For: AG-494


2,582  results were found

Refine Results Sort by
SearchResultCount:"2582"

Sort Results

List View Easy View

Rate These Search Results

Product Image-CA28297-930

VWR® Quantitative Filter Paper, Grade 494

Supplier: VWR International
Description: Useful for very fine precipitates such as barium and lead sulfates, stannic and nickel sulfides, and calcium hydroxide.

Certificates

Image Unavailable-CA80054-314

(R)-Roscovitine, Calbiochem®

Supplier: MilliporeSigma
Description: A potent and selective inhibitor of cyclin-dependent kinases (cdks) that exhibits about ten-fold greater efficacy towards p34cdc2 and p33cdk2, and twenty-fold greater efficacy towards p33cdk5 relative to olomoucine (80053-494, -496)

Certificates

Image Unavailable-77123-380

Anti-FCGR3A Mouse Monoclonal Antibody [clone: [GRM1]]

Catalog Number: (77123-380)
Supplier: Prosci
Description: Anti-FCGR3A Mouse Monoclonal Antibody [clone: [GRM1]]
Product Image-76309-168

Color Polyester Labels, Brady

Supplier: Brady Worldwide
Description: Add color to reduce errors and increase efficiency with B-494 color polyester labels. The design allows users to differentiate lab samples in a snap.

Image Unavailable-103006-064

Human Beta-Amyloid (1-42), FAM (Carboxyfluorescein)

Catalog Number: (103006-064)
Supplier: Anaspec Inc
Description: This is a fluorescent 5-FAM labeled scrambled Beta-Amyloid peptide, Abs/Em=494/521 nm.
Sequence: 5-FAM-AIAEGDSHVLKEGAYMEIFDVQGHVFGGKIFRVVDLGSHNVA
MW: 4873.4
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C
Image Unavailable-CAAAA17192-03

Menthofuran 95%

Supplier: Thermo Scientific Chemicals
Description: Menthofuran 95%

Certificates

Image Unavailable-103005-942

520 MMP FRET Substrate XIV, QXL™ 520-FAM, AnaSpec

Catalog Number: (103005-942)
Supplier: Anaspec Inc
Description: Matrix Metalloproteinases (MMPs) are a large family of endopeptidases. Collectively, MMPs can degrade all kinds of extracellular matrix proteins, and can also process a number of bioactive molecules. They are known to be involved in the cleavage of cell surface receptors, the release of apoptotic ligands, and chemokine/cytokine inactivation. MMPs are also thought to play a major role in cell behaviors such as cell proliferation, migration (adhesion/dispersion), differentiation, angiogenesis, apoptosis, and host defense.
This peptide is a sensitive substrate for assaying MMP-1, 2, 3, 7, 8, 9, 12, and 13 activities, Abs/Em = 494/521 nm.
Sequence:QXL™ 520 -γ-Abu-P-Cha-Abu-Smc-HA-Dab(5-FAM)-AK-NH2 (Smc=S-Methyl-L-cysteine)
MW:1913.1 Da
% peak area by HPLC:95
Storage condition:-20° C
Image Unavailable-103006-970

Histone H1-derived Peptide, FAM (Carboxyfluorescein)

Catalog Number: (103006-970)
Supplier: Anaspec Inc
Description: This is a FAM-labeled Histone H1-derived peptide (Ab/Em = 494/521 nm). Histone H1-derived peptide phosphorylated by protein kinase A, is a substrate for CDK2 and CDK5 (cyclin dependent kinase 5) and PKA.
Sequence:5-FAM-GGGPATPKKAKKL
MW:1610.8 Da
% peak area by HPLC:95
Storage condition:-20° C
Image Unavailable-103006-122

Human BAD (103-127), FAM (Carboxyfluorescein)

Catalog Number: (103006-122)
Supplier: Anaspec Inc
Description: This is a BCL2-antagonist of cell death peptide fragment that is fluorescently labeled with FAM, Abs/Em=494/521 nm.
Sequence:FAM-NLWAAQRYGRELRRMSDEFVDSFKK
MW:3461.8 Da
% peak area by HPLC:95
Storage condition:-20° C
Image Unavailable-103005-948

5-FAM MMP FRET Peptide Fluorescence Standard I, FAM (Carboxyfluorescein), AnaSpec

Catalog Number: (103005-948)
Supplier: Anaspec Inc
Description: Matrix Metalloproteinases (MMPs) are a large family of endopeptidases. Collectively, MMPs can degrade all kinds of extracellular matrix proteins, and can also process a number of bioactive molecules. They are known to be involved in the cleavage of cell surface receptors, the release of apoptotic ligands, and chemokine/cytokine inactivation. MMPs are also thought to play a major role in cell behaviors such as cell proliferation, migration (adhesion/dispersion), differentiation, angiogenesis, apoptosis, and host defense.
This peptide contains 5-FAM only and is similar to the proteolytic product of the 520 MMP FRET substrates. It can be used to set up the fluorescence standard curve. Abs/Em = 494/521 nm.
Sequence:5-FAM-PL
MW:586.6 Da
% peak area by HPLC:95
Storage condition:-20° C
Product Image-50000-520

Accessories for High-Pressure Syringes, Antron Engineering

Supplier: Antron Engineering
Description: Syringe tips are interchangeable with high-pressure syringes (see <B>50000-494</B> series).

Image Unavailable-103358-662

Anti-NOD1 Rabbit Polyclonal Antibody

Catalog Number: (103358-662)
Supplier: Novus Biologicals
Description: The NOD1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to NOD1. This antibody reacts with human. The NOD1 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunoprecipitation, Immunohistochemistry-Paraffin.
Image Unavailable-102996-396

Human Glucagon-Like Peptide 1, GLP-1 amide, FAM-labeled

Catalog Number: (102996-396)
Supplier: Anaspec Inc
Description: This is fluorescent GLP-1 labeled at the peptide C-terminus with FAM, Abs/Em=494/521 nm. In response to Glucose ingestion, proglucagon in the intestinal L cells is cleaved into GLP-1 (1-36). Prior to secretion into the circulation, GLP-1 (1-36) is further processed into amidated GLP-1 (7-36)-and small amounts of glycine-extended GLP-1 (7-37). Both GLP-1 (7-36) and GLP-1 (7-37), causes glucose dependent release of insulin by pancreatic beta-cells. They also play a role in gastric motility (gastric emptying), on the suppression of plasma glucagon levels (glucose production) and possibly on the promotion of satiety and stimulation of glucose disposal in peripheral tissues independent of the actions of insulin. GLP-1 peptides such as GLP-1 (1-36) have been used to investigate restoration of pancreatic beta cell function. GLP-1 is also produced in the central nervous system.
Sequence: FAM-HDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2
MW: 4469.8 Da
% Peak area by HPLC: 95
Storage condition: -20° C
Image Unavailable-103003-246

520 MMP FRET Substrate V, QXL™ 520-FAM, AnaSpec

Catalog Number: (103003-246)
Supplier: Anaspec Inc
Description: Matrix Metalloproteinases (MMPs) are a large family of endopeptidases. Collectively, MMPs can degrade all kinds of extracellular matrix proteins, and can also process a number of bioactive molecules. They are known to be involved in the cleavage of cell surface receptors, the release of apoptotic ligands, and chemokine/cytokine inactivation. MMPs are also thought to play a major role in cell behaviors such as cell proliferation, migration (adhesion/dispersion), differentiation, angiogenesis, apoptosis, and host defense.
This peptide is a sensitive substrate for assaying MMP-1, 2, 7, 8, 12 and 13 activities, Abs/Em = 494/521 nm.
Sequence:5-FAM-PLGL-Dap(QXL™ 520)-AR-NH2
MW:1560.6 Da
% peak area by HPLC:95
Storage condition:-20° C
Image Unavailable-103005-944

520 MMP FRET Substrate XV, QXL™ 520-FAM, AnaSpec

Catalog Number: (103005-944)
Supplier: Anaspec Inc
Description: Matrix Metalloproteinases (MMPs) are a large family of endopeptidases. Collectively, MMPs can degrade all kinds of extracellular matrix proteins, and can also process a number of bioactive molecules. They are known to be involved in the cleavage of cell surface receptors, the release of apoptotic ligands, and chemokine/cytokine inactivation. MMPs are also thought to play a major role in cell behaviors such as cell proliferation, migration (adhesion/dispersion), differentiation, angiogenesis, apoptosis, and host defense.
This peptide is a sensitive substrate for assaying MMP-1, 2, 7, 8, 12, 13 and 14 activities, Abs/Em = 494/521 nm.
Sequence:QXL™ 520 -γ-Abu-PQGL-Dab(5-FAM)-AK-NH2
MW:1647.7 Da
% peak area by HPLC:95
Storage condition:-20° C
Product Image-82027-494

VWR® Round/Flat Spatulas, Stainless Steel

Supplier: VWR International
Description: Ideal for transferring, collecting, mixing, or handling chemical or biological samples.

Certificates

Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
You must log in to order restricted items. We request that you provide the required business documentation to purchase this product for the first time.

To order chemicals, medical devices, or other restricted products please provide identification that includes your business name and shipping address via email CMD_NA@vwr.com or fax 484.881.5997 referencing your VWR account number . Acceptable forms of identification are:

  • issued document with your organization's Federal Tax ID Number
  • Government issued document with your organization's Resale Tax ID Number
  • Any other Government ID that includes the business name and address


VWR will not lift restrictions for residential shipping addresses.

-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is currently unavailable but limited stock may be available in our extended warehouse network. Please call 1-800-932-5000 and a VWR Customer Service Representative will help you.
17 - 32 of 2,582
no targeter for Bottom