You Searched For: Tetrabutylammonium+perchlorate


1,527  results were found

Sort Results

List View Easy View
SearchResultCount:"1527"
Description: Anti-Dectin-1 Rabbit Monoclonal Antibody [clone: EPR28032-27]
Catalog Number: ABCA_AB311845-1ML
Supplier: Abcam

New Product


Description: Heat Shock Protein BAP1 (heat shock 27-kDa-associated protein 1, or HSPBAP1) inhibits the function of heat shock protein 27, which has a neuroprotective effect during experimentally induced epileptic neuropathology. The HSPBAP1 protein, also known as PASS1, contains a jmjC motif, suggesting it is a member of the jumonji family of transcription factors. There is evidence of domain swapping within the jumonji family genes, and the HSPBAP1 gene has been shown to fuse with a novel gene called DIRC3 in hereditary renal cell cancer.
Catalog Number: 10459-112
Supplier: Bioss


Description: Calcium dye
Catalog Number: 89165-940
Supplier: Enzo Life Sciences


Description: PE anti-mouse CD49e [5H10-27(MFR5)]; Isotype: Rat IgG2a, κ; Reactivity: Mouse; Apps: FC; Size: 50 μg
Catalog Number: CA103805-BL
Supplier: Biolegend


Description: [Spectrophotometric reagent for alkaline earth metals and indicator for the precipitation titration of SO4 with Ba]
CAS Number: 68504-35-8
MDL Number: MFCD00003942
Molecular Formula: C22H16N4O14S4
Molecular Weight: 776.55
Purity/Analysis Method: >90.0% (HPLC)
Form: Crystal
Catalog Number: TCA5010-005G
Supplier: TCI America

Description: Spectrophotometric reagent for alkaline earth metals and indicator for sulfate titrations
Catalog Number: CAAAA10486-06
Supplier: Thermo Scientific Chemicals

Description: IL-27 is expressed in activated antigen presenting cells including monocytes, endothelial cells, and dendritic cells, for example mouse CD4 splenocytes. This purified antibody has been tested for use in western blotting.
Catalog Number: RL210-403-B54
Supplier: Rockland Immunochemical


Description: 2-(4-Fluorophenyl)benzimidazole, 95%
Catalog Number: AAH64531-03
Supplier: Thermo Scientific Chemicals

Description: Anti-BACE1 Rabbit Monoclonal Antibody [clone: 27] (PE)
Catalog Number: ABCA_AB275651-100T
Supplier: Abcam

New Product


Description: MDL: MFCD00149588 Beilstein Registry No.: 4100175
Catalog Number: CAAAA10927-14
Supplier: Thermo Scientific Chemicals

Description: Purified anti-human IL-1β [H1b-27]; Isotype: Mouse IgG2b, κ; Reactivity: Human; Apps: ELISA Capture; Size: 500 μg
Catalog Number: CA511601-BL
Supplier: Biolegend


Description: Tube clamp is molded of strong, durable plastic with serrated jaws 2.7 cm (1¹⁄₁₆") long.
Catalog Number: 70690-116
Supplier: Bel-Art Products, a Part of SP


Description: Anti-H2-D1 Mouse Monoclonal Antibody [clone: [27-11-13S]]
Catalog Number: 77122-376
Supplier: Prosci


Description: 1,3-Benzenediboronic Acid Bis(pinacol) Ester, Purity: >98%(GC), CAS: 196212-27-8, MF: C18H28B2O4, MW: 330.04, Synonyms: 1,3-Bis(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)benzene, 1,3-Phenylenebis(4,4,5,5-tetramethyl-1,3,2-dioxaborolane), Size: 1G
Catalog Number: 76218-808
Supplier: TCI America


Description: This peptide is a potent antagonist of PACAP 38 and is much more potent and selective than PACAP (6-27) in the inhibition of PACAP-27 stimulated pituitary adenylate cyclase. The Ki values for the inhibition of the enzyme are 7nM and 150 nM, respectively.
Sequence: FTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK-NH2
MW: 4024.8 Da
% Peak area by HPLC: 95
Storage condition: -20° C
Catalog Number: 102996-260
Supplier: Anaspec Inc


Description: Anti-Fas Ligand Rabbit Monoclonal Antibody [clone: EPR25843-27]
Catalog Number: ABCA_AB300690-1MG
Supplier: Abcam

New Product


961 - 976 of 1,527