Print…

You Searched For: 6-Bromochromone-2-carboxylic+acid


66,011  results were found

Refine Results Sort by
SearchResultCount:"66011"

Sort Results

List View Easy View

Rate These Search Results

Image Unavailable-TCP1349-025G

Ethyl piperazine-1-carboxylate ≥96.0%

Catalog Number: (TCP1349-025G)
Supplier: TCI America
Description: CAS Number: 120-43-4
MDL Number: MFCD00005964
Molecular Formula: C7H14N2O2
Molecular Weight: 158.20
Purity/Analysis Method: >96.0% (GC)
Form: Clear Liquid
Color: Slightly Pale Yellow
Boiling point (°C): 237
Flash Point (°C): 113
Specific Gravity (20/20): 1.09

SDS


Image Unavailable-TCA1039-100G

Methyl-3-aminothiophene-2-carboxylate ≥98.0% (by GC, titration analysis)

Supplier: TCI America
Description: CAS Number: 22288-78-4
MDL Number: MFCD00009765
Molecular Formula: C6H7NO2S
Molecular Weight: 157.19
Purity/Analysis Method: >98.0% (GC,T)
Form: Crystal
Boiling point (°C): 102
Melting point (°C): 65
Flash Point (°C): 100

SDS Certificates

Image Unavailable-TCB3735-25G

tert-Butyl-2,5-dihydro-1H-pyrrole-1-carboxylate ≥98.0% (by GC)

Supplier: TCI America
Description: CAS Number: 73286-70-1
MDL Number: MFCD01863512
Molecular Formula: C9H15NO2
Molecular Weight: 169.22
Purity/Analysis Method: >98.0% (GC)
Form: Crystal
Boiling point (°C): 75
Melting point (°C): 41
Flash Point (°C): 81

SDS Certificates

Product Image-10072-294

Human Recombinant Esd (from E. coli)

Catalog Number: (10072-294)
Supplier: Prosci
Description: A carboxylic ester + H2O = an alcohol + a carboxylic anion. Homodimer. Cytoplasmic vesicles. There are two major electrophoretic isotypes. The sequence of the ESD*1 variant is shown. Similar to yeast HRE299.
Product Image-CA11006-194

PureCoat™ Amine and Carboxyl Plates, Corning®

Supplier: Corning
Description: Corning PureCoat™ amine (positively charged) and carboxyl (negatively charged) surfaces provide improved cell attachment, faster cell proliferation, and enhanced recovery post-thaw over standard TC surfaces.

Certificates

Image Unavailable-CAAAH61701-03

Ethyl-6-chloropicolinate 97%

Supplier: Thermo Scientific Chemicals
Description: Ethyl 6-chloropyridine-2-carboxylate, 97%

Certificates

Image Unavailable-103009-388

Human Des-gamma-carboxylated Osteocalcin/Bone Gla Protein

Catalog Number: (103009-388)
Supplier: Anaspec Inc
Description: This peptide is des-gamma-carboxylated osteocalcin/bone Gla protein (BGP). Osteocalcin/BGP is the most abundant non-collagenous protein of the bone extracellular matrix and is secreted by osteoblasts. This des-gamma-carboxylated peptide serves as a substrate for vitamin K-dependent carboxylase, which modifies Glu17, Glu21, and Glu24 to Gla residues.
Sequence: YLYQWLGAPVPYPDPLEPRREVCELNPDCDELADHIGFQEAYRRFYGPV (Disulfide bridge:C23-29)
MW: 5797.5 Da
% Peak area by HPLC: 95
Storage condition: -20° C
Product Image-77524-308

Human UCHL1 (Ubiquitin Carboxyl Terminal Hydrolase L1) ELISA Kit

Catalog Number: (77524-308)
Supplier: AFG Bioscience
Description: Human UCHL1 (Ubiquitin Carboxyl Terminal Hydrolase L1) ELISA Kit
Product Image-89151-114

HA14-1 ≥95% (by 1H-NMR)

Supplier: Enzo Life Sciences
Description: Bcl-2 ligand.

Product Image-76712-668

Human Pyrroline 5 Carboxylate Reductase 3 (PYCRL) ELISA Kit

Catalog Number: (76712-668)
Supplier: AFG Bioscience
Description: Human Pyrroline 5 Carboxylate Reductase 3 (PYCRL) ELISA Kit
Image Unavailable-CAAAJ62807-MC

Tropisetron hydrochloride

Catalog Number: (CAAAJ62807-MC)
Supplier: Thermo Scientific Chemicals
Description: A selective 5-HT3 serotonin receptor antagonist

Certificates


Product Image-77524-694

Rat UCHL1 (Ubiquitin Carboxyl Terminal Hydrolase L1) ELISA Kit

Catalog Number: (77524-694)
Supplier: AFG Bioscience
Description: Rat UCHL1 (Ubiquitin Carboxyl Terminal Hydrolase L1) ELISA Kit
Image Unavailable-TCG0458-100MG

Genipin ≥97.0% (by GC)

Supplier: TCI America
Description: Genipin, Purity: >97.0%(GC), CAS number: 6902-77-8, Molecular Formula: C11H14O5, MW: 226.23, Synonym: Methyl (1S,2R,6S)-2-Hydroxy-9-(hydroxymethyl)-3-oxabicyclo[4.3.0]nona-4,8-diene-5-carboxylate, Physical state: Solid, Form: Crystal- Powder, Colour: White - Almost white, Size: 25MG

SDS Certificates

Image Unavailable-TCC3045-1G

Coumarin 504T ≥98.0% (by HPLC, total nitrogen)

Supplier: TCI America
Description: Coumarin 504T, CAS: 113869-06-0, Purity: 98.0% HPLC, Molecular Formula: C22H27NO4, Molecular Weight: 369.46 g/mol, Synonyms: Ethyl 2,3,6,7-Tetrahydro-1,1,7,7-tetramethyl-11-oxo-1H,5H,11H-[1]benzopyrano[6,7,8-ij]quinolizine-10-carboxylate, Physical Form: Solid, Size: 200MG

SDS

Image Unavailable-AAH63657-03

L-Proline-tert-butyl ester 98%

Supplier: Thermo Scientific Chemicals
Description: L-Proline tert-butyl ester, 98%

SDS Certificates

Product Image-77524-692

Mouse UCHL1 (Ubiquitin Carboxyl Terminal Hydrolase L1) ELISA Kit

Catalog Number: (77524-692)
Supplier: AFG Bioscience
Description: Mouse UCHL1 (Ubiquitin Carboxyl Terminal Hydrolase L1) ELISA Kit
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
You must log in to order restricted items. We request that you provide the required business documentation to purchase this product for the first time.

To order chemicals, medical devices, or other restricted products please provide identification that includes your business name and shipping address via email CMD_NA@vwr.com or fax 484.881.5997 referencing your VWR account number . Acceptable forms of identification are:

  • issued document with your organization's Federal Tax ID Number
  • Government issued document with your organization's Resale Tax ID Number
  • Any other Government ID that includes the business name and address


VWR will not lift restrictions for residential shipping addresses.

-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is currently unavailable but limited stock may be available in our extended warehouse network. Please call 1-800-932-5000 and a VWR Customer Service Representative will help you.
1,377 - 1,392 of 66,011
no targeter for Bottom