You Searched For: MICRONOVA+MFG+INC

Description: Mono-reactive dye pack contains derivatised CyDye™ that carries only one reactive group on each dye molecule for targeted and specific labeling of amine groups, for example on antibodies, peptides or oligonucleotides.

Catalog Number: CA95017-354L

Supplier: Cytiva

SDS Sale

Description: Primary Rabbit Anti-PDGFR beta(pTyr 751 ) Reacts with Human, Mouse, Rat

Catalog Number: CA82602-476

Supplier: MilliporeSigma

Sale

Description: This is amino acids 1 to 22 fragment of the beta-amyloid peptide.
Sequence: DAEFRHDSGYEVHHQKLVFFAE
Molecular Weight: 2661.9 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C

Catalog Number: 103007-582

Supplier: Anaspec Inc

Sale

Description: Mouse beta -NGF is a neurotrophic factor structurally related to BDNF, NT-3 and NT-4. These proteins belong to the cysteine-knot family of growth factors that assume stable dimeric structures. beta -NGF is a potent neurotrophic factor that signals through its receptor beta -NGFR, and plays a crucial role in the development and preservation of the sensory and sympathetic nervous systems. beta -NGF also acts as a growth and differentiation factor for B lymphocytes, and enhances B-cell survival.

Catalog Number: 75789-930

Supplier: Prosci

Sale

Description: Rabbit polyclonal antibody to CD97 beta (cleaved Ser531)

Catalog Number: 89289-492

Supplier: Genetex

Sale

Description: Rabbit Polyclonal antibody to CaMKK beta (calcium/calmodulin-dependent protein kinase kinase 2, beta)

Catalog Number: 89355-448

Supplier: Genetex

Sale

Description: IKK beta (I-Kappa-B kinase-beta) is a member of the IKK complex which is composed of IKK alpha, IKK beta, IKK gamma and IKAP. Phosphorylation of I-Kappa-B on a serine residue by the IKK complex frees NF-kB from I-Kappa-B and marks it for degradation via ubiquination. IKK beta has been shown to activate NF-kB and phosphorylate IKB alpha and beta. Phosphorylation of 2 sites at the activation loop of IKK beta is essential for activation of IKK by TNF and IL1. Once activated, IKK beta autophosphorylates which in turn decreases IKK activity and prevents prolonged activation of the inflammatory response. Additionally, IKK beta activity can also be regulated by MEKK1.

Catalog Number: 76080-394

Supplier: Bioss

Sale

Description: This is cysteine-modified N-terminus of Beta-Amyloid (1-42).
Cysteine modification of beta-amyloid peptides enables specific immobilization via maleimide-terminated surface at the N-terminal cysteine to the mica surface usually used in AFM interaction studies. Since the N-terminal is not involved in fibril formation, certain studies have adopted this strategy of immobilizing the peptide using the maleimide-cystein linkage/functionalization and study Beta-Amyloid interactions.
Sequence: CDAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA
Molecular Weight: 4617.3 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C

Catalog Number: 102999-618

Supplier: Anaspec Inc

Sale

Description: cAMP-Dependent Protein Kinase Inhibitor beta (PKI- beta ) is a member of the PKI family. It has been shown that PKI- beta is an extremely potent competitive inhibitor of cAMP-dependent protein kinase activity; this protein interacts with the catalytic subunit of the enzyme after the cAMP-induced dissociation of its regulatory chains.

Catalog Number: 75789-170

Supplier: Prosci

Sale

Description: The beta Tubulin Antibody from Novus Biologicals is a rabbit polyclonal antibody to beta Tubulin. This antibody reacts with human, mouse, rat, bovine, canine, chicken, feline, monkey, primate, xenopus. The beta Tubulin Antibody has been validated for the following applications: Western Blot, Simple Western, Immunohistochemistry, Immunohistochemistry-Paraffin.

Catalog Number: 103359-172

Supplier: Novus Biologicals

Sale

Description: IKK beta (I-Kappa-B kinase-beta) is a member of the IKK complex which is composed of IKK alpha, IKK beta, IKK gamma and IKAP. Phosphorylation of I-Kappa-B on a serine residue by the IKK complex frees NF-kB from I-Kappa-B and marks it for degradation via ubiquination. IKK beta has been shown to activate NF-kB and phosphorylate IKB alpha and beta. Phosphorylation of 2 sites at the activation loop of IKK beta is essential for activation of IKK by TNF and IL1. Once activated, IKK beta autophosphorylates which in turn decreases IKK activity and prevents prolonged activation of the inflammatory response. Additionally, IKK beta activity can also be regulated by MEKK1.

Catalog Number: 76080-392

Supplier: Bioss

Sale

Description: Transforming Growth Factor beta -1 (TGF beta -1) is a secreted protein which belongs to the TGF- beta family. TGF beta -1 is abundantly expressed in bone, articular cartilage and chondrocytes and is increased in osteoarthritis (OA). TGF beta -1 performs many cellular functions, including the control of cell growth, cell proliferation, cell differentiation and apoptosis. The precursor is cleaved into a latency-associated peptide (LAP) and a mature TGF beta -1 peptide. TGF beta -1 may also form heterodimers with other TGF beta family members. It has been found that TGF beta -1 is frequently upregulated in tumor cells. Mutations in this gene results in Camurati-Engelmann disease.

Catalog Number: 75790-178

Supplier: Prosci

Sale

Description: Platelet-Derived Growth Factor Receptor beta (PDGFR- beta ) is a member of the protein kinase superfamily and CSF-1/PDGF receptor subfamily. The PDGF family consists of PDGF-A, -B, -C and -D, which form either homo- or heterodimers (PDGF-AA, -AB, -BB, -CC, -DD). The four PDGFs are inactive in their monomeric forms. The PDGFs bind to the protein tyrosine kinase receptors PDGF receptor- alpha and - beta . These two receptor isoforms dimerize upon binding the PDGF dimer, leading to three possible receptor combinations, namely - alpha alpha, - beta beta and - alpha beta . The extracellular region of the PDGF receptor- beta consists of five immunoglobulin-like domains while the intracellular part is a tyrosine kinase domain. In addition to being a potent mitogen for cells of mesenchymal origin, PDGF has also been shown to be a potent chemoattractant for mesenchymal cells, mononuclear cells, and neutrophils and has been reported to be important in the modification of cellular matrix constituents.

Catalog Number: 75789-372

Supplier: Prosci

Certificates Sale

Description: Transforming Growth Factor (TGF) betas mediate many cell to cell interactions that occur during embryonic development. Three TGF betas have been identified in mammals. TGF beta 1, TGF beta 2 and TGF beta 3 are each synthesized as precursor proteins that are very similar in that each is cleaved to yield a 112 amino acid polypeptide that remains associated with the latent portion of the molecule. The TGF beta polypeptides are multifunctional; capable of influencing cell proliferation, differentiation, and other functions in a wide range of cell types. Transformed, as well as nonneoplastic tissues, release transforming growth factors; and essentially all mammalian cells possess a specific TGF receptor. The multi modal nature of TGF beta is seen in its ability to stimulate or inhibit cellular proliferation. In general, cells of mesenchymal origin appear to be stimulated by TGF beta whereas cells of epithelial or neuroectodermal origin are inhibited by the peptide. TGF beta 1, TGF beta 2, and TGF beta 1.2 appear to be equivalent in biological activity, although there does appear to be differences in binding to certain types of receptors. TGF beta 2 is produced by many cell types and has been found in the highest concentration in porcine platelets and mammalian bone. Latent TGF beta 2 is the prominent isoform found in body fluids such as amniotic fluid, breast milk, and the aqueous and vitreous humor of the eye.

Catalog Number: 10231-156

Supplier: Bioss

Sale

Description: This peptide is beta-Amyloid (1-13), human sequence.
Sequence: DAEFRHDSGYEVH
Molecular Weight: 1561.6 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C

Catalog Number: 103008-192

Supplier: Anaspec Inc

Sale

Description: Transforming Growth Factor (TGF) betas mediate many cell to cell interactions that occur during embryonic development. Three TGF betas have been identified in mammals. TGF beta 1, TGF beta 2 and TGF beta 3 are each synthesized as precursor proteins that are very similar in that each is cleaved to yield a 112 amino acid polypeptide that remains associated with the latent portion of the molecule. The TGF beta polypeptides are multifunctional; capable of influencing cell proliferation, differentiation, and other functions in a wide range of cell types. Transformed, as well as nonneoplastic tissues, release transforming growth factors; and essentially all mammalian cells possess a specific TGF receptor. The multi modal nature of TGF beta is seen in its ability to stimulate or inhibit cellular proliferation. In general, cells of mesenchymal origin appear to be stimulated by TGF beta whereas cells of epithelial or neuroectodermal origin are inhibited by the peptide. TGF beta 1, TGF beta 2, and TGF beta 1.2 appear to be equivalent in biological activity, although there does appear to be differences in binding to certain types of receptors. TGF beta 2 is produced by many cell types and has been found in the highest concentration in porcine platelets and mammalian bone. Latent TGF beta 2 is the prominent isoform found in body fluids such as amniotic fluid, breast milk, and the aqueous and vitreous humor of the eye.

Catalog Number: 10231-158

Supplier: Bioss

Sale