Print…

You Searched For: Levels


4,729  results were found

Refine Results Sort by

Sort Results

List View Easy View
SearchResultCount:"4729"

Rate These Search Results

Image Unavailable-CAAA11589-A3

ZINC PHOSPHATE TECH GRD 2KG

Catalog Number: CAAA11589-A3
Supplier: Thermo Scientific Chemicals

Certificates


Image Unavailable-CAAA11589-36

ZINC PHOSPHATE TECH GRD 500G

Catalog Number: CAAA11589-36
Supplier: Thermo Scientific Chemicals

Certificates


Image Unavailable-CAAAB21096-06

DIETHL (PHTHALIMIDOMETHL)PH 5G

Catalog Number: CAAAB21096-06
Supplier: Thermo Scientific Chemicals

Certificates


Image Unavailable-CAAAB21096-14

DIETHL (PHTHALIMIDOMETHL)P 25G

Catalog Number: CAAAB21096-14
Supplier: Thermo Scientific Chemicals

Certificates


Image Unavailable-102996-422

BNP-32 0.5 mg

Description: BNP-32, human, Purity: HPLC >/= to 95%, Molecular Weight: 3464.1, Sequence: SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH, Appearance: Lyophilized white powder, It is also called the brain natriuretic peptide because it was first identified in porcine brain, Storage: -20 deg C, Size: 0.5 mg
Catalog Number: 102996-422
Supplier: Anaspec Inc
Image Unavailable-75791-996

IFN alpha-2b Recombinant Protein

Description: IFN alpha-2b Recombinant Protein, Species: Human, Source: E. Coli, Sequence: Cys24-Glu188, Fusion tag: Tag Free, Purity: Greater than 95% by SDS-PGE, Physical state: Lyophilized, Synonyms: Interferon Alpha-2, IFN-Alpha-2, Interferon Alpha-A, LeIF A, Size: 50ug
Catalog Number: 75791-996
Supplier: Prosci
Image Unavailable-10778-388

Recombinant Human IL-22

Description: Recombinant Human IL-22, 33.6 kDa, non-disulfide-linked, homodimeric protein consisting of two 147 amino acid polypeptide chains, Animal Free, Source: E.coli, Synonymns: Interleukin-22, IL-TIF, Cytokine ZCYTO18, Purity: > 98% by SDS-PAGE gel and HPLC analyses, 50UG
Catalog Number: 10778-388
Supplier: Peprotech
Image Unavailable-10778-386

Recombinant Human IL-22

Description: Recombinant Human IL-22, 33.6 kDa, non-disulfide-linked, homodimeric protein consisting of two 147 amino acid polypeptide chains, Animal Free, Source: E.coli, Synonymns: Interleukin-22, IL-TIF, Cytokine ZCYTO18, Purity: > 98% by SDS-PAGE gel and HPLC analyses, 100UG
Catalog Number: 10778-386
Supplier: Peprotech
Image Unavailable-10778-384

Recombinant Human IL-22

Description: Recombinant Human IL-22, 33.6 kDa, non-disulfide-linked, homodimeric protein consisting of two 147 amino acid polypeptide chains, Animal Free, Source: E.coli, Synonymns: Interleukin-22, IL-TIF, Cytokine ZCYTO18, Purity: > 98% by SDS-PAGE gel and HPLC analyses, 10UG
Catalog Number: 10778-384
Supplier: Peprotech
Image Unavailable-10778-390

Recombinant Human IL-22

Description: Recombinant Human IL-22, 33.6 kDa, non-disulfide-linked, homodimeric protein consisting of two 147 amino acid polypeptide chains, Animal Free, Source: E.coli, Synonymns: Interleukin-22, IL-TIF, Cytokine ZCYTO18, Purity: > 98% by SDS-PAGE gel and HPLC analyses, 500UG
Catalog Number: 10778-390
Supplier: Peprotech
Image Unavailable-TCG0282-5G

(R)-Glycidyl Butyrate, Min 98.0% (GC)

Description: 5G Synonym: Butyric Acid (R)-Glycidyl Ester, MDL Number: 00075120, Beilstein: 17(005)03,0034, Mol. Formula: C7H12O3, Mol. Wt.: 144.17, Reaxys: 5246881, PubChem SID: 87570461, CAS: 60456-26-0, 60456-26-0, C7H12O3, 144.17
Catalog Number: TCG0282-5G
Supplier: TCI America

SDS


Image Unavailable-TCG0282-25G

(R)-Glycidyl Butyrate, Min 98.0% (GC)

Description: 25G Synonym: Butyric Acid (R)-Glycidyl Ester, MDL Number: 00075120, Beilstein: 17(005)03,0034, Mol. Formula: C7H12O3, Mol. Wt.: 144.17, Reaxys: 5246881, PubChem SID: 87570461, CAS: 60456-26-0, 60456-26-0, C7H12O3, 144.17
Catalog Number: TCG0282-25G
Supplier: TCI America

SDS


Image Unavailable-10072-846

IL-20 Recombinant Protein, Species: Human, Host: E. coli

Catalog Number: 10072-846
Supplier: Prosci
Image Unavailable-10779-752

Recombinant Human IL-22

Description: Recombinant Human IL-22, 33.6kDa, non-disulfide-linked, homodimeric protein consisting of two 147 AA polypeptide chains, IL-10 family of regulatory cytokines, Source: E.coli, Cross Reactivity: Human, Monkey, >98%, Synonym: Interleukin-22, IL-TIF, Cytokine ZCYTO18, 2UG
Catalog Number: 10779-752
Supplier: Peprotech

Certificates


Image Unavailable-10779-762

Recombinant Human IL-22

Description: Recombinant Human IL-22, 33.6kDa, non-disulfide-linked, homodimeric protein consisting of two 147 AA polypeptide chains, IL-10 family of regulatory cytokines, Source: E.coli, Cross Reactivity: Human, Monkey, >98%, Synonym: Interleukin-22, IL-TIF, Cytokine ZCYTO18, 1MG
Catalog Number: 10779-762
Supplier: Peprotech

Certificates


Image Unavailable-10779-756

Recombinant Human IL-22

Description: Recombinant Human IL-22, 33.6 kDa, non-disulfide-linked, homodimeric protein consisting of two 147 AA polypeptide chains, IL-10 family of regulatory cytokines, Source: E.coli, Cross Reactivity: Human, Monkey, >98%, Synonyms: Interleukin-22, IL-TIF, Cytokine ZCYTO18, 100UG
Catalog Number: 10779-756
Supplier: Peprotech

Certificates


545 - 560 of 4,729