You Searched For: Cesium+sulphate


61,476  results were found

Sort Results

List View Easy View
SearchResultCount:"61476"
Description: Complete. 125 mL. 38 x 298 mm. Porosity:EC. Stopper No.29/42. For additional information on fritted ware, see PP T.23-T.24 of Technical Section.
Catalog Number: 16408-087
Supplier: Corning

Description: Complete. 250 mL. 51 x 290 mm. Porosity:EC. Stopper No.29/42. For additional information on fritted ware, see PP T.23-T.24 of Technical Section.
Catalog Number: 16408-101
Supplier: Corning

Description: Mca-APP770 (667-676)-Lys(Dnp)-Arg-Arg amide.
Catalog Number: M-2460.0005BA
Supplier: Bachem Americas


Description: Mca-APP770 (667-676)-Lys(Dnp)-Arg-Arg amide.
Catalog Number: M-2460.0001BA
Supplier: Bachem Americas


Catalog Number: 77618-822
Supplier: SCHULER SCIENTIFIC

New Product


Catalog Number: 77618-824
Supplier: SCHULER SCIENTIFIC

New Product


Description: MMP-12 ELISA Kit, Species Reactivity: Mouse, Synonyms: EC 3.4.24.65, HME, Macrophage elastase, Macrophage metalloelastase, Macrophage metaloelastase, Matrix metallopeptidase 12 (macrophage elastase), Matrix metalloprotease 12, Matrix metalloproteinase-12, Size: 1 Kit
Catalog Number: 76235-766
Supplier: Rockland Immunochemical


Description: MMP-2 ELISA Kit, Species Reactivity: Mouse, Synonyms: 73 kDa gelatinase, 72 kDa type IV collagenase, CLG 4, CLG 4A, CLG4, CLG4A, Collagenase type IV A, EC 3.4.24.24, Gelatinase A, Gelatinase alpha, Gelatinase neutrophil, Matrix metallopeptidase 2, Size: 1 Kit
Catalog Number: 76236-740
Supplier: Rockland Immunochemical


Description: MMP-2 ELISA Kit, Species Reactivity: Human, Synonyms: 72 kDa gelatinase, 72 kDa type IV collagenase, CLG 4, CLG 4A, CLG4, CLG4A, Collagenase type IV A, EC 3.4.24.24, Gelatinase A, Gelatinase alpha, Gelatinase neutrophil, Matrix metallopeptidase 2, Size: 1 Kit
Catalog Number: 76236-738
Supplier: Rockland Immunochemical


Catalog Number: CA23735-20
Supplier: Hach


Description: Polyclonal, Host: Rabbit, Species: Human, Mouse, Rat, Immunogen: Produced in rabbits immunized with a synthetic peptide corresponding a region of human RTCD1. purified by peptide affinity chromatography method. Tested Applications: Elisa, Western blot
Catalog Number: 10102-362
Supplier: Prosci


Description: Big Endothelin-1 (1-38), human, Sequence: CSCSSLMDKECVYFCHLDIIWVNTPEHVVPYGLGSPRS (Disulfide bridge: 1-15 and 3-11), Purity: By HPLC >/= 95%, Big Endothelin-1 (1-38) is precursor of endothelin 1, Molecular Weight: 4283, Storage: -20 C, Size: 0.5 mg
Catalog Number: 103007-562
Supplier: Anaspec Inc


Catalog Number: 102995-908
Supplier: MilliporeSigma


Description: Polytron* Generator, PT-DA 20/2EC-E192, Dispersing Aggregate, or Homogeniser POLYTRON* 2500 E, Alternate names: Homogenisers heads, Dispersing heads, Saw tooth stator adds extra cutting action, length 192mm, Diameter: 25 mm
Catalog Number: 76360-420
Supplier: Kinematica

Small Business Enterprise


Description: Polytron* Generator, PT-DA 20/2EC-E192, Dispersing Aggregate, or Homogeniser POLYTRON* 2500 E, Alternate names: Homogenisers heads, Dispersing heads, Saw tooth stator adds extra cutting action, length 192mm, Diameter: 20 mm
Catalog Number: 76360-418
Supplier: Kinematica

Small Business Enterprise


Description: TIE2 ELISA Kit, Species Reactivity: Human, Synonyms: CD202b, CD202b antigen, EC 2.7.10.1, hTIE2, p140 TEK, soluble TIE2 variant 1, soluble TIE2 variant 2, Tek, TEK tyrosine kinase, endothelial, TIE 2, TIE2_HUMAN, Tunica interna endothelial cell kinase, Size: 1 Kit
Catalog Number: 76236-784
Supplier: Rockland Immunochemical


561 - 576 of 61,476