You Searched For: 4-Bromo-L-phenylalanine

Catalog Number: (10108-126)

Supplier: Prosci

Description: Aminoacyl-tRNA synthetases are a class of enzymes that charge tRNAs with their cognate amino acids. FARS2 is a phenylalanine-tRNA synthetase (PheRS) localized to the mitochondrion which consists of a single polypeptide chain, unlike the (alpha-beta)2 structure of the prokaryotic and eukaryotic cytoplasmic forms of PheRS. Structure analysis and catalytic properties indicate mitochondrial PheRSs may constitute a class of PheRS distinct from the enzymes found in prokaryotes and in the eukaryotic cytoplasm.Aminoacyl-tRNA synthetases are a class of enzymes that charge tRNAs with their cognate amino acids. FARS1 encodes a mitochondrially-located phenylalanine-tRNA synthetase (PheRS) which consists of a single polypeptide chain unlike the (alpha-beta)2 structure of the prokaryotic and eukaryotic cytoplasmic forms of PheRS. Structure analysis and catalytic properties indicate mitochondrial PheRSs may constitute a class of PheRS distinct from the enzymes found in prokaryotes and the eukaryotic cytoplasm.

Catalog Number: (10232-144)

Supplier: Bioss

Description: GTP cyclohydrolase I (also designated dopa-responsive dystonia) catalyzes the conversion of GTP to D-erythro-7,8-dihydroneopterin triphosphate, the first and rate-limiting step in tetrahydrobiopterin (BH4) biosynthesis. Tetrahydrobiopterin is an essential cofactor for 3 aromatic amino acid monooxygenases: phenylalanine, tyrosine, and tryptophan hydroxylases. Animals can synthesize tetrahydrobiopterin in vivo from GTP through several enzymatic reactions.

Catalog Number: (103009-064)

Supplier: Anaspec Inc

Description: This peptide is beta-amyloid (1-38) with phenylalanine and isoleucine universally labeled with 13C. Ab is found in amyloid deposits of Alzheimer’s patients and is implicated in the pathogenesis of this disease.
Sequence: DAEFRHDSGYEVHHQKLV-*F-*F-AEDVGSNKGA-*I-*I-GLMVGG *F=Phe(U-13C9), *I=Ile(U-13C6)
Molecular Weight: 4161.6 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C

Catalog Number: (10751-344)

Supplier: Prosci

Description: TYW4 Antibody: TYW4 is an enzyme that participates in the wybutosine-tRNA (Phe) biosynthesis pathway. Wybutosine (yW) is a hypermodified guanosine at the 3-prime position adjacent to the anticodon of phenylalanine tRNA that stabilizes codon-anticodon interactions during decoding on the ribosome. TYW4 is involved in a multistep enzymatic reaction that stabilizes codon-anticodon base-pairing during the ribosomal decoding process, thereby ensuring correct translation.

Catalog Number: (10751-342)

Supplier: Prosci

Description: TYW3 Antibody: TYW3 is an enzyme that participates in the wybutosine-tRNA (Phe) biosynthesis pathway. Wybutosine (yW) is a hypermodified guanosine at the 3-prime position adjacent to the anticodon of phenylalanine tRNA that stabilizes codon-anticodon interactions during decoding on the ribosome. TYW3 is involved in a multistep enzymatic reaction that stabilizes codon-anticodon base-pairing during the ribosomal decoding process, thereby ensuring correct translation.

Catalog Number: (103008-238)

Supplier: Anaspec Inc

Description: This 37-amino acid peptide is the beta form of Calcitonin-gene-related peptide (β-CGRP), involved extensively in regulation of the cardiovascular and nervous systems. β-CGRP contains a disulphide bridge at the N-terminus, a C-terminal phenylalanine amide important for immune recognition, and an a-helix between residues 8 and 18.
Sequence:ACNTATCVTHRLAGLLSRSGGMVKSNFVPTNVGSKAF-NH2 (Disulfide bridge:2-7)
MW:3793.4 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C

Catalog Number: (77440-680)

Supplier: Bioss

Description: DNAJB12 belongs to the evolutionarily conserved DNAJ/HSP40 family of proteins, which regulate molecular chaperone activity by stimulating ATPase activity. DNAJ proteins may have up to 3 distinct domains: a conserved 70-amino acid J domain, usually at the N terminus; a glycine/phenylalanine (G/F)-rich region; and a cysteine-rich domain containing 4 motifs resembling a zinc finger domain (Ohtsuka and Hata, 2000 (PubMed 11147971)).(supplied by OMIM, Mar 2008).

Catalog Number: (10092-924)

Supplier: Proteintech

Description: Dihydropteridine reductase (QDPR), also named as DHPR and HDHPR, is an essential enzyme in the hydroxylating system of the aromatic amino acids, since it catalyses the regeneration of tetrahydrobiopterin (BH4), the natural cofactor of phenylalanine, tyrosine, and tryptophan hydroxylases, from the quininoid-dihydrobiopterin produced in these coupled reactions. The QDPR protein is active as a dimer, with a subunit Mr of 26 kDa. This protein belongs to the short-chain dehydrogenases/reductases (SDR) family. Defects in QDPR are the cause of BH4-deficient hyperphenylalaninemia type C (HPABH4C).

Catalog Number: (75790-626)

Supplier: Prosci

Description: 4-Hydroxyphenylpyruvate Dioxygenase (4HPPD) belongs to the 4HPPD family. 4HPPD is a key enzyme in the degradation of tyrosine, which catalyzes the second reaction in the catabolism of tyrosine the conversation of 4-hydroxyphenylpyruvate to homogentisate. 4HPPD exists in homodimer forms, which uses zinc as a cofactor to catalyze the third step in the conversion of L-phenylalanine to fumarate and acetoacetic acid. When the active 4HPPD enzyme concentration is low in the human body, it results in high levels of tyrosine concentration in the blood, which can cause mild mental retardation at birth, and degradation in vision as a patient grows older.

Catalog Number: (76099-998)

Supplier: Bioss

Description: HGD is a 445 amino acid protein that belongs to the homogentisate dioxygenase family and is involved in the pathway of amino acid degradation. Expressed at high levels in kidney, colon, liver, prostate and small intestine, HGD uses iron as a cofactor to catalyze the oxygen-dependent conversion of homogentisate to 4-maleylacetoacetate, a reaction that is the fourth step in the creation of L-phenylalanine from fumarate and acetoacetic acid. Defects in the gene encoding HGD are the cause of alkaptonuria (AKU), an autosomal recessive disorder that is characterized by urine that turns dark on standing and alkalinization, black ochronotic pigmentation of cartilage and collagenous tissues and spine arthritis.

Catalog Number: (103006-288)

Supplier: Anaspec Inc

Description: Dby HY Peptide, NAGFNSNRANSSRSS, is a HYAb epitope belonging to a well-conserved family of genes coding for known or putative RNA helicases and containing a core sequence with a DEAD (Asp-Glu-Ala-Asp) box peptide motif, hence the name Dby (Dead box RNA helicase Y). The single Phenylalanine in the sequence serves as the anchor point while FNSNRANSS most likely is the “core” sequence of this HYAb epitope.
Sequence:NAGFNSNRANSSRSS
MW:1568.6 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: (76100-000)

Supplier: Bioss

Description: HGD is a 445 amino acid protein that belongs to the homogentisate dioxygenase family and is involved in the pathway of amino acid degradation. Expressed at high levels in kidney, colon, liver, prostate and small intestine, HGD uses iron as a cofactor to catalyze the oxygen-dependent conversion of homogentisate to 4-maleylacetoacetate, a reaction that is the fourth step in the creation of L-phenylalanine from fumarate and acetoacetic acid. Defects in the gene encoding HGD are the cause of alkaptonuria (AKU), an autosomal recessive disorder that is characterized by urine that turns dark on standing and alkalinization, black ochronotic pigmentation of cartilage and collagenous tissues and spine arthritis.

Catalog Number: (10751-340)

Supplier: Prosci

Description: TYW2 Antibody: TYW2, also known as TRM12, is an enzyme that participates in the wybutosine-tRNA (Phe) biosynthesis pathway. Wybutosine (yW) is a hypermodified guanosine at the 3-prime position adjacent to the anticodon of phenylalanine tRNA that stabilizes codon-anticodon interactions during decoding on the ribosome. TYW2 is involved in a multistep enzymatic reaction that stabilizes codon-anticodon base-pairing during the ribosomal decoding process, thereby ensuring correct translation. TYW2 was found to be amplified in 7 of 8 breast cancers cell lines analyzed, and qPCR analysis of 30 breast tumors showed overexpression of TYW2 mRNA of over 2-fold in 26, suggesting that TYW2 may play a role in breast cancer.

Supplier: Biotium

Description: This antibody recognizes a cluster of proteins between 70-80 kDa, identified as tyrosinase. Occasionally a minor band at 55 kDa is also detected. This MAb shows no cross-reaction with MAGE-1 and tyrosinase-related protein 1, TRP-1/gp75. Tyrosinase is a copper-containing metalloglycoprotein that catalyzes several steps in the melanin pigment biosynthetic pathway; the hydroxylation of tyrosine to L-3,4-dihydroxy-phenylalanine (dopa), and the subsequent oxidation of dopa to dopaquinone. Mutations of the tyrosinase gene occur in various forms of albinism. Tyrosinase is one of the targets for cytotoxic T-cell recognition in melanoma patients. Staining of melanomas with this MAb shows tyrosinase in melanotic as well as amelanotic variants. This MAb is a useful marker for melanocytes and melanomas.

Supplier: Biotium

Description: This antibody recognizes a cluster of proteins between 70-80 kDa, identified as tyrosinase. Occasionally a minor band at 55 kDa is also detected. This MAb shows no cross-reaction with MAGE-1 and tyrosinase-related protein 1, TRP-1/gp75. Tyrosinase is a copper-containing metalloglycoprotein that catalyzes several steps in the melanin pigment biosynthetic pathway; the hydroxylation of tyrosine to L-3,4-dihydroxy-phenylalanine (dopa), and the subsequent oxidation of dopa to dopaquinone. Mutations of the tyrosinase gene occur in various forms of albinism. Tyrosinase is one of the targets for cytotoxic T-cell recognition in melanoma patients. Staining of melanomas with this MAb shows tyrosinase in melanotic as well as amelanotic variants. This MAb is a useful marker for melanocytes and melanomas.

Catalog Number: (10049-410)

Supplier: Enzo Life Sciences

Description: The thymidine analogue BrdU (5-Bromo-2-Deoxyuridine), a derivative of uridine, can substitute for thymidine during DNA synthesis. The detection of BrdU incorporation into DNA provides a common method to quantify newly synthesized DNA and identify cells in the S-phase of the cell cycle. The use of BrdU incorporation in proliferation assays facilitates the study of DNA repair, sister chromatid exchange, and the cytokinetics of normal and neoplastic cells.