Print…

You Searched For: 4-Bromo-2,2-diphenylbutyric+acid


77,871  results were found

Refine Results Sort by
SearchResultCount:"77871"

Sort Results

List View Easy View

Rate These Search Results

Image Unavailable-CAAAAL19530-03

2-Phenylethylboronic acid pinacol ester 99%

Supplier: Thermo Scientific Chemicals
Description: 2-Phenylethylboronic acid pinacol ester 99%

Product Image-10787-820

Human Recombinant IL-22 (from E. coli)

Supplier: FUJIFILM IRVINE SCIENTIFIC, INC
Description: Interleukin 22 (IL-22), also called IL-TIF, is an IL-10 family member that is produced by activated dendritic cells and T lymphocytes. IL-22 signals via a heteroduplex receptor consisting of IL-22R and IL-10Rbeta chains. IL-22 is a potent mediator of cellular inflammatory responses. 

Image Unavailable-103007-214

Human [Lys22]-beta-Amyloid (1-40)

Catalog Number: (103007-214)
Supplier: Anaspec Inc
Description: This is amino acids 1 to 40 fragment of the beta-amyloid peptide with lysine substituted for glutamic acid at position 22, found in Italian families. The Italian mutation of beta-amyloid 1-40 (E22K) aggregates more rapidly and with more potent neurotoxicity than wild-type beta-amyloid 1-40. The formation of a salt bridge between Lys-22 and Asp-23 in the minor conformer might be a reason why E22K-beta-amyloid 40 is more pathogenic than wild-type beta-amyloid 40.
Sequence: DAEFRHDSGYEVHHQKLVFFAKDVGSNKGAIIGLMVGGVV
Molecular Weight: 4328.9 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C
Image Unavailable-TCB4605-1G

3-Bromo-2-thenoic acid ≥98.0% (by GC, titration analysis)

Supplier: TCI America
Description: 3-Bromothiophene-2-carboxylic Acid, Purity: >98.0%(GC)(T), Cas no. 7311-64-0, Molecular formula: C5H3BrO2S, Form: Crystal- Powder, Colour: White - Very pale yellow, Size: 5G

SDS

Image Unavailable-TCB4898-1G

4-Bromo-2,6-dichlorobenzoic acid ≥98.0% (by GC, titration analysis)

Catalog Number: (TCB4898-1G)
Supplier: TCI America
Description: 4-Bromo-2,6-dichlorobenzoic Acid, Purity: 98%, Cas no. 232275-51-3, Molecular formula: C7H3BrCl2O2, Form: Crystal - Powder, Colour: White - Pale yellow, Size: 1G

SDS


Image Unavailable-CA80051-690

FLUO 3/AM ≥95% fluorescent indicator, for calcium determination, Calbiochem®

Catalog Number: (CA80051-690)
Supplier: MilliporeSigma
Description: Membrane-permeable version of FLUO 3

Certificates


Image Unavailable-TCB3386-25G

4-Bromo-2-thenoic acid ≥98.0% (by GC, titration analysis)

Supplier: TCI America
Description: CAS Number: 16694-18-1
MDL Number: MFCD03422294
Molecular Formula: C5H3BrO2S
Molecular Weight: 207.04
Purity/Analysis Method: >98.0% (GC,T)
Form: Crystal
Melting point (°C): 122
Lambda max.: 245 nm (EtOH)

SDS Certificates

Image Unavailable-CAAAA19630-06

3-Bromo-2-(bromomethyl)propionic acid 98%

Supplier: Thermo Scientific Chemicals
Description: 3-Bromo-2-(bromomethyl)propionic acid 98%

Certificates

Image Unavailable-TCB2133-001G

3-Bromo-4-fluorobenzoic acid ≥96.0% (by titrimetric analysis)

Supplier: TCI America
Description: CAS Number: 1007-16-5
MDL Number: MFCD00042463
Molecular Formula: C7H4BrFO2
Molecular Weight: 219.01
Purity/Analysis Method: >96.0% (T)
Form: Crystal
Melting point (°C): 139

SDS

Image Unavailable-10666-572

Anti-C22ORF31 Rabbit Polyclonal Antibody (Cy7®)

Catalog Number: (10666-572)
Supplier: Bioss
Description: C22orf31, also known as HS747E2A or bK747E2.1, is a 290 amino acid protein encoded by a gene located on human chromosome 22, which contains over 500 genes and about 49 million bases. As the second smallest human chromosome, chomosome 22 contains a wide variety of genes with numerous functions. Phelan-McDermid syndrome, Neurofibromatosis type 2 and autism are associated with chromosome 22. A schizophrenia susceptibility locus has been identified on chromosome 22 and studies show that 22q11 deletion symptoms include a high incidence of schizophrenia. Translocations between chromosomes 9 and 22 may lead to the formation of the Philadelphia Chromosome and the subsequent production of the novel fusion protein, BCR-Abl, a potent cell proliferation activator found in several types of leukemia.
Image Unavailable-10666-554

Anti-C22orf31 Rabbit Polyclonal Antibody

Catalog Number: (10666-554)
Supplier: Bioss
Description: C22orf31, also known as HS747E2A or bK747E2.1, is a 290 amino acid protein encoded by a gene located on human chromosome 22, which contains over 500 genes and about 49 million bases. As the second smallest human chromosome, chomosome 22 contains a wide variety of genes with numerous functions. Phelan-McDermid syndrome, Neurofibromatosis type 2 and autism are associated with chromosome 22. A schizophrenia susceptibility locus has been identified on chromosome 22 and studies show that 22q11 deletion symptoms include a high incidence of schizophrenia. Translocations between chromosomes 9 and 22 may lead to the formation of the Philadelphia Chromosome and the subsequent production of the novel fusion protein, BCR-Abl, a potent cell proliferation activator found in several types of leukemia.
Image Unavailable-10666-570

Anti-C22ORF31 Rabbit Polyclonal Antibody (Cy5.5®)

Catalog Number: (10666-570)
Supplier: Bioss
Description: C22orf31, also known as HS747E2A or bK747E2.1, is a 290 amino acid protein encoded by a gene located on human chromosome 22, which contains over 500 genes and about 49 million bases. As the second smallest human chromosome, chomosome 22 contains a wide variety of genes with numerous functions. Phelan-McDermid syndrome, Neurofibromatosis type 2 and autism are associated with chromosome 22. A schizophrenia susceptibility locus has been identified on chromosome 22 and studies show that 22q11 deletion symptoms include a high incidence of schizophrenia. Translocations between chromosomes 9 and 22 may lead to the formation of the Philadelphia Chromosome and the subsequent production of the novel fusion protein, BCR-Abl, a potent cell proliferation activator found in several types of leukemia.
Image Unavailable-TCB3221-5G

3-Bromo-o-toluic acid ≥98.0% (by GC, titration analysis)

Supplier: TCI America
Description: CAS Number: 76006-33-2
MDL Number: MFCD00270097
Molecular Formula: C8H7BrO2
Molecular Weight: 215.05
Purity/Analysis Method: >98.0% (GC,T)
Form: Crystal
Melting point (°C): 154

SDS

Image Unavailable-TCB4017-1G

2-Bromo-6-fluorobenzoic acid ≥98.0% (by GC, titration analysis)

Supplier: TCI America
Description: CAS Number: 2252-37-1
MDL Number: MFCD01569539
Molecular Formula: C7H4BrFO2
Molecular Weight: 219.01
Purity/Analysis Method: >98.0% (GC,T)
Form: Crystal
Melting point (°C): 156

SDS

Image Unavailable-10477-080

Anti-CCDC117 Rabbit Polyclonal Antibody (FITC (Fluorescein Isothiocyanate))

Catalog Number: (10477-080)
Supplier: Bioss
Description: CCDC117 is a 279 amino acid protein that is expressed as multiple alternatively spliced isoforms and is encoded by a gene which maps to human chromosome 22. Chromosome 22 houses over 500 genes and is the second smallest human chromosome. Mutations in several of the genes that map to chromosome 22 are involved in the development of Phelan-McDermid syndrome, Neurofibromatosis type 2, autism and schizophrenia. Additionally, translocations between chromosomes 9 and 22 may lead to the formation of the Philadelphia chromosome and the subsequent production of the novel fusion protein Bcr-Abl, a potent cell proliferation activator found in several types of leukemias.
Image Unavailable-F-2980.0001BA

trans-4-Hydroxy-D-proline

Supplier: Bachem Americas
Description: Sequence: H-D-Hyp-OH

Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
You must log in to order restricted items. We request that you provide the required business documentation to purchase this product for the first time.

To order chemicals, medical devices, or other restricted products please provide identification that includes your business name and shipping address via email CMD_NA@vwr.com or fax 484.881.5997 referencing your VWR account number . Acceptable forms of identification are:

  • issued document with your organization's Federal Tax ID Number
  • Government issued document with your organization's Resale Tax ID Number
  • Any other Government ID that includes the business name and address


VWR will not lift restrictions for residential shipping addresses.

-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is currently unavailable but limited stock may be available in our extended warehouse network. Please call 1-800-932-5000 and a VWR Customer Service Representative will help you.
433 - 448 of 77,871
no targeter for Bottom