Print…

You Searched For: 4-Bromo-2,2-diphenylbutyric+acid


73,494  results were found

Refine Results Sort by
SearchResultCount:"73494"

Sort Results

List View Easy View

Rate These Search Results

Image Unavailable-103007-214

Human [Lys22]-beta-Amyloid (1-40)

Catalog Number: (103007-214)
Supplier: Anaspec Inc
Description: This is amino acids 1 to 40 fragment of the beta-amyloid peptide with lysine substituted for glutamic acid at position 22, found in Italian families. The Italian mutation of beta-amyloid 1-40 (E22K) aggregates more rapidly and with more potent neurotoxicity than wild-type beta-amyloid 1-40. The formation of a salt bridge between Lys-22 and Asp-23 in the minor conformer might be a reason why E22K-beta-amyloid 40 is more pathogenic than wild-type beta-amyloid 40.
Sequence: DAEFRHDSGYEVHHQKLVFFAKDVGSNKGAIIGLMVGGVV
Molecular Weight: 4328.9 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C
Image Unavailable-CA80051-690

FLUO 3/AM ≥95% fluorescent indicator, for calcium determination, Calbiochem®

Catalog Number: (CA80051-690)
Supplier: MilliporeSigma
Description: Membrane-permeable version of FLUO 3

Certificates


Image Unavailable-TCB1617-100MG

1-Bromo-2-naphthoic acid ≥98.0% (by GC, titration analysis)

Supplier: TCI America
Description: CAS Number: 20717-79-7
MDL Number: MFCD00021408
Molecular Formula: C11H7BrO2
Molecular Weight: 251.08
Purity/Analysis Method: >98.0% (GC,T)
Form: Crystal
Melting point (°C): 191

SDS

Product Image-10821-798

Mouse Recombinant IL-22 (Animal free) (from E. coli)

Supplier: FUJIFILM IRVINE SCIENTIFIC, INC
Description: Interleukin 22 (IL-22), also called IL-TIF, is an IL-10 family member that is produced by activated dendritic cells and T lymphocytes. IL-22 signals via a heteroduplex receptor consisting of IL-22R and IL-10RB chains. IL-22 is a potent mediator of cellular inflammatory responses and wound healing.  

Image Unavailable-TCB5077-1G

6-Bromo-2-pyridineboronic acid pinacol ester ≥98.0% (by GC, titration analysis)

Supplier: TCI America
Description: 2-Bromo-6-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)pyridine, Purity: >98.0%(GC)(T), CAS Number: 651358-83-7, Molecular Formula: C11H15BBrNO2, Synonyms: 6-Bromo-2-pyridylboronic Acid Pinacol Ester, Size: 5G

Image Unavailable-TCB3386-25G

4-Bromo-2-thenoic acid ≥98.0% (by GC, titration analysis)

Supplier: TCI America
Description: CAS Number: 16694-18-1
MDL Number: MFCD03422294
Molecular Formula: C5H3BrO2S
Molecular Weight: 207.04
Purity/Analysis Method: >98.0% (GC,T)
Form: Crystal
Melting point (°C): 122
Lambda max.: 245 nm (EtOH)

SDS Certificates

Product Image-101410-880

Aniline blue 2.5% in 2% acetic acid

Catalog Number: (101410-880)
Supplier: Electron Microscopy Sciences
Description: Aniline Blue Electron Microscopy Sciences solution is a prepared, ready-to-use, high quality staining solutions for standard staining procedures used by the Biological Staining Commission and the Armed Forces Institute of Pathology. Available in concentrations of 2.5% in 2% Acetic Acid, Phosphomolybdic Acid Solution, and with Orange G.

Minority or Woman-Owned Business Enterprise


Image Unavailable-TCB3322-25G

2-Bromo-3-nitrobenzoic acid ≥98.0% (by titrimetric analysis)

Supplier: TCI America
Description: CAS Number: 573-54-6
MDL Number: MFCD00074899
Molecular Formula: C7H4BrNO4
Molecular Weight: 246.02
Purity/Analysis Method: >98.0% (T)
Form: Crystal
Melting point (°C): 188

SDS Certificates

Image Unavailable-CAAAA14331-06

5,5'-Dithiobis(2-nitrobenzoic acid) (Ellmans reagent, DTNB) 99%

Supplier: Thermo Scientific Chemicals
Description: Reagent for determination of sufhydryl groups

Certificates

Image Unavailable-10666-572

Anti-C22ORF31 Rabbit Polyclonal Antibody (Cy7®)

Catalog Number: (10666-572)
Supplier: Bioss
Description: C22orf31, also known as HS747E2A or bK747E2.1, is a 290 amino acid protein encoded by a gene located on human chromosome 22, which contains over 500 genes and about 49 million bases. As the second smallest human chromosome, chomosome 22 contains a wide variety of genes with numerous functions. Phelan-McDermid syndrome, Neurofibromatosis type 2 and autism are associated with chromosome 22. A schizophrenia susceptibility locus has been identified on chromosome 22 and studies show that 22q11 deletion symptoms include a high incidence of schizophrenia. Translocations between chromosomes 9 and 22 may lead to the formation of the Philadelphia Chromosome and the subsequent production of the novel fusion protein, BCR-Abl, a potent cell proliferation activator found in several types of leukemia.
Image Unavailable-TCM2543-25G

Methyl-3-bromo-2-methylbenzoate ≥98.0% (by GC)

Supplier: TCI America
Description: Methyl 3-Bromo-2-methylbenzoate, Purity: >98.0%(GC), CAS Number: 99548-54-6, Molecular Formula: C9H9BrO2, Molecular Weight: 229.07, Synonyms: 3-Bromo-2-methylbenzoic Acid Methyl Ester, 3-Bromo-o-toluic Acid Methyl Ester, Methyl 3-Bromo-o-toluate, Size: 5G

SDS

Image Unavailable-10666-570

Anti-C22ORF31 Rabbit Polyclonal Antibody (Cy5.5®)

Catalog Number: (10666-570)
Supplier: Bioss
Description: C22orf31, also known as HS747E2A or bK747E2.1, is a 290 amino acid protein encoded by a gene located on human chromosome 22, which contains over 500 genes and about 49 million bases. As the second smallest human chromosome, chomosome 22 contains a wide variety of genes with numerous functions. Phelan-McDermid syndrome, Neurofibromatosis type 2 and autism are associated with chromosome 22. A schizophrenia susceptibility locus has been identified on chromosome 22 and studies show that 22q11 deletion symptoms include a high incidence of schizophrenia. Translocations between chromosomes 9 and 22 may lead to the formation of the Philadelphia Chromosome and the subsequent production of the novel fusion protein, BCR-Abl, a potent cell proliferation activator found in several types of leukemia.
Image Unavailable-CAAAH33181-03

5-Bromo-2-pyridineacetic acid 98%

Catalog Number: (CAAAH33181-03)
Supplier: Thermo Scientific Chemicals

Certificates


Image Unavailable-10666-554

Anti-C22orf31 Rabbit Polyclonal Antibody

Catalog Number: (10666-554)
Supplier: Bioss
Description: C22orf31, also known as HS747E2A or bK747E2.1, is a 290 amino acid protein encoded by a gene located on human chromosome 22, which contains over 500 genes and about 49 million bases. As the second smallest human chromosome, chomosome 22 contains a wide variety of genes with numerous functions. Phelan-McDermid syndrome, Neurofibromatosis type 2 and autism are associated with chromosome 22. A schizophrenia susceptibility locus has been identified on chromosome 22 and studies show that 22q11 deletion symptoms include a high incidence of schizophrenia. Translocations between chromosomes 9 and 22 may lead to the formation of the Philadelphia Chromosome and the subsequent production of the novel fusion protein, BCR-Abl, a potent cell proliferation activator found in several types of leukemia.
Image Unavailable-CAAAH59899-06

3-Methyl-1H-pyrazole-5-carboxylic acid 97%

Supplier: Thermo Scientific Chemicals

Certificates

Product Image-CA11016-986

trans-1,2-Diaminocyclohexane-N,N,N',N'-tetraacetic acid (CDTA) 0.800 M, cartridge for digital titrator

Catalog Number: (CA11016-986)
Supplier: Hach
Description: Cyclohexanediamine tetraacetic acid standard solution. For Calcium and Total Hardness determination by Digital Titrator titration.
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
You must log in to order restricted items. We request that you provide the required business documentation to purchase this product for the first time.

To order chemicals, medical devices, or other restricted products please provide identification that includes your business name and shipping address via email CMD_NA@vwr.com or fax 484.881.5997 referencing your VWR account number . Acceptable forms of identification are:

  • issued document with your organization's Federal Tax ID Number
  • Government issued document with your organization's Resale Tax ID Number
  • Any other Government ID that includes the business name and address


VWR will not lift restrictions for residential shipping addresses.

-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is currently unavailable but limited stock may be available in our extended warehouse network. Please call 1-800-932-5000 and a VWR Customer Service Representative will help you.
433 - 448 of 73,494
no targeter for Bottom