Print…

You Searched For: 4-Bromo-2,2-diphenylbutanenitrile


10,160  results were found

Refine Results Sort by
SearchResultCount:"10160"

Sort Results

List View Easy View

Rate These Search Results

Image Unavailable-TCD4015-25G

Daminozide (succinic acid mono(2,2-dimethylhydrazide)) ≥98.0% (by GC, titration analysis)

Supplier: TCI America
Description: CAS Number: 1596-84-5
MDL Number: MFCD00002787
Molecular Formula: C6H12N2O3
Molecular Weight: 160.17
Purity/Analysis Method: >98.0% (GC,T)
Form: Crystal
Melting point (°C): 155

SDS Certificates

Image Unavailable-75791-888

Mouse Recombinant IL22

Catalog Number: (75791-888)
Supplier: Prosci
Description: Interleukin-22 (IL-22) was initially identified as a gene induced by IL-9 in mouse T cells and mast cells. Mouse IL-22 cDNA encodes a 179 amino acid residue protein with a putative 33 amino acid signal peptide that is cleaved to generate a 147 amino acid mature protein that shares approximately 79% and 22% sequence identity with human IL22 and IL10, respectively. IL22 has been shown to activate STAT-1 and STAT-3 in several hepatoma cell lines and up-regulate the production of acute phase proteins. IL-22 is produced by normal mouse T cells upon Con A activation. Mouse IL-22 expression is also induced in various organs upon lipopolysaccharide injection, suggesting that IL-22 may be involved in inflammatory responses. The functional IL-22 receptor complex consists of two receptor subunits, IL-22R (previously an orphan receptor named CRF2-9) and IL-10R beta (previously known as CRF2-4), belonging to the class II cytokine receptor family.
Image Unavailable-103003-156

Human Adrenomedullin (22-52)

Catalog Number: (103003-156)
Supplier: Anaspec Inc
Description: AM (22-52) is known as an adrenomedullin receptor antagonist and a cardiac depressant factor, although there is some discrepancy in the literature regarding the selectivity of ADM 22-52 as adrenomedullin receptor antagonist.
Sequence:TVQKLAHQIYQFTDKDKDNVAPRSKISPQGY-NH2
MW:3576 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C
Image Unavailable-CA8.02936.0500

Acetonedimethyl acetal for synthesis, Sigma-Aldrich®

Supplier: MilliporeSigma
Description: 2,2-Dimethoxypropane, CAS number:77-76-9, Synonyms:Acetone dimethyl acetal, Application:for synthesis

SDS

Image Unavailable-10780-032

Mouse Recombinant IL-22 (from E. coli)

Supplier: Peprotech
Description: IL-22 is a member of the IL-10 family of regulatory cytokines, which includes IL-10, IL-19, IL-20, IL-22, IL-24 and IL-26. Members of this family share partial homology in their amino acid sequences, but they are dissimilar in their biological functions. Produced by T lymphocytes, IL-22 inhibits IL-4 production by Th2 cells, and induces acute phase reactants in the liver and pancreas. IL-22 signals through a receptor system consisting of IL-10Rβ/CRF2-4 and IL-22R, both of which are members of the class II cytokine-receptor family. Recombinant Murine IL-22 is a 33.4 kDa, non-disulfide-linked, homodimeric protein consisting of two 147 amino acid polypeptide chains.

Product Image-76709-674

Human Nuclear Matrix Protein 22 (NMP 22) ELISA Kit

Catalog Number: (76709-674)
Supplier: AFG Bioscience
Description: Human Nuclear Matrix Protein 22 (NMP 22) ELISA Kit
Image Unavailable-TCD0575-025G

2,2'-Dihydroxy-4,4'-dimethoxybenzophenone ≥90.0%

Catalog Number: (TCD0575-025G)
Supplier: TCI America
Description: CAS Number: 131-54-4
MDL Number: MFCD00009606
Molecular Formula: C15H14O5
Molecular Weight: 274.27
Purity/Analysis Method: >90.0% (GC)
Form: Crystal
Melting point (°C): 135

SDS Certificates


Product Image-89214-720

VWR® Upright Freezer Racks for 15 and 50 ml Centrifuge Tubes, Stainless Steel

Supplier: VWR International
Description: Durable stainless steel freezer racks facilitate organization and maximize valuable storage space.

Small Business Enterprise

Product Image-76699-854

Rat Fibroblast Growth Factor-22 (FGF-22) ELISA Kit

Catalog Number: (76699-854)
Supplier: AFG Bioscience
Description: Rat Fibroblast Growth Factor-22 (FGF-22) ELISA Kit
Product Image-89214-676

VWR® Upright Freezer Racks for 3" Boxes, Stainless Steel

Supplier: VWR International
Description: Durable stainless steel freezer racks facilitate organization and maximize valuable storage space.

Small Business Enterprise

Image Unavailable-TCP0584-025G

4-Phenylazo-1-naphthylamine ≥95.0% (by titrimetric analysis)

Catalog Number: (TCP0584-025G)
Supplier: TCI America
Description: CAS Number: 131-22-6
MDL Number: MFCD00004025
Molecular Formula: C16H13N3
Molecular Weight: 247.30
Purity/Analysis Method: >95.0% (T)
Form: Crystal

SDS Certificates


Image Unavailable-76077-500

Mouse Recombinant IL-22 (from E. coli)

Supplier: Peprotech
Description: Animal-Free Murine IL-22 Recombinant Protein, Purity: >98%, Source: E.coli, Biological Activity: By its ability to induce IL-10 secretion in COLO 205 (human colon carcinoma cells), Synonyms: Interleukin-22

Image Unavailable-CAAAH60112-MD

(R)-2,2'-Bis[bis(3,5-di-tert-butyl-4-methoxyphenyl)phosphino]-4,4',6,6'-tetramethoxybiphenyl ≥97%

Supplier: Thermo Scientific Chemicals
Description: 97+% 1G

Product Image-CA11029-122

Anti-IL22 Rabbit Polyclonal Antibody

Catalog Number: (CA11029-122)
Supplier: Rockland Immunochemical
Description: Anti-Human Il-22 (Rabbit) Antibody - Il-22 Purified Antibody Has Been Tested For Use In ELISA And Western Blotting. Expect A Band Approximately 20 Kda In Size Corresponding To The Human Il-22 Protein By Western Blotting In Appropriate Cell Or Extract.
Product Image-CA11029-244

Anti-IL22 Rabbit Polyclonal Antibody

Catalog Number: (CA11029-244)
Supplier: Rockland Immunochemical
Description: Anti-Human Il-22 (Rabbit) Antibody - Il-22 Purified Antibody Has Been Tested For Use In ELISA And Western Blotting. Expect A Band Approximately 20 Kda In Size Corresponding To The Human Il-22 Protein By Western Blotting In Appropriate Cell Or Extract.
Product Image-89214-708

VWR® Upright Freezer Racks for 96 Deep Well Microtiter Plates, Stainless Steel

Supplier: VWR International
Description: Durable stainless steel freezer racks facilitate organization and maximize valuable storage space.

Small Business Enterprise

Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
You must log in to order restricted items. We request that you provide the required business documentation to purchase this product for the first time.

To order chemicals, medical devices, or other restricted products please provide identification that includes your business name and shipping address via email CMD_NA@vwr.com or fax 484.881.5997 referencing your VWR account number . Acceptable forms of identification are:

  • issued document with your organization's Federal Tax ID Number
  • Government issued document with your organization's Resale Tax ID Number
  • Any other Government ID that includes the business name and address


VWR will not lift restrictions for residential shipping addresses.

-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is currently unavailable but limited stock may be available in our extended warehouse network. Please call 1-800-932-5000 and a VWR Customer Service Representative will help you.
545 - 560 of 10,160
no targeter for Bottom