Print…

You Searched For: Nickel+chromite


65,239  results were found

Refine Results Sort by

Sort Results

List View Easy View
SearchResultCount:"65239"

Rate These Search Results

Product Image-470211-338

PYREX® Heavy-Duty-Grade Beakers

Description: Made of PYREX® borosilicate glass.
Catalog Number: 470211-338
Supplier: Corning

Certificates


Image Unavailable-TCB3513-25G

2-Bromo-1,3,5-triisopropylbenzene ≥95.0% (by GC)

Description: CAS Number: 21524-34-5
MDL Number: MFCD00051547
Molecular Formula: C15H23Br
Molecular Weight: 283.25
Purity/Analysis Method: >95.0% (GC)
Form: Clear Liquid
Boiling point (°C): 148
Flash Point (°C): 110
Specific Gravity (20/20): 1.13
Catalog Number: TCB3513-25G
Supplier: TCI America

SDS Certificates


Image Unavailable-AAJ60679-MD

4-Thiouridine ≥98%

Description: Crystalline
Catalog Number: AAJ60679-MD
Supplier: Thermo Scientific Chemicals

Certificates


Image Unavailable-TCP1896-100MG

5-Azaindole ≥98.0% (by GC, titration analysis)

Description: CAS Number: 271-34-1
MDL Number: MFCD00955936
Molecular Formula: C7H6N2
Molecular Weight: 118.14
Purity/Analysis Method: >98.0% (GC,T)
Form: Crystal
Color: White
Boiling point (°C): 132
Melting point (°C): 113
Lambda max.: 264 nm (H2O)
Catalog Number: TCP1896-100MG
Supplier: TCI America

SDS


Image Unavailable-TCT3357-25G

o-Tolyl trifluoromethanesulfonate ≥98.0% (by GC)

Description: O-Tolyl Trifluoromethanesulfonate, Purity/Analysis Method: >98.0%(GC), CAS Number: 66107-34-4, Molecular formula: C8H7F3O3S, Molecular weight: 240.20, Synonym: o-Tolyl Triflate, Trifluoromethanesulfonic Acid o-Tolyl Ester, Size: 5G
Catalog Number: TCT3357-25G
Supplier: TCI America
Image Unavailable-89319-332

Anti-FAHD2A Rabbit Polyclonal Antibody

Description: Rabbit polyclonal antibody to CDC34 (cell division cycle 34 homolog (S. cerevisiae))
Catalog Number: 89319-332
Supplier: Genetex
Image Unavailable-TCA2523-100MG

Biotin-PEG3-azide ≥95.0% (by HPLC)

Description: CAS Number: 875770-34-6
MDL Number: MFCD20134145
Molecular Formula: C18H32N6O5S
Molecular Weight: 444.55
Purity/Analysis Method: >95.0% (HPLC)
Form: Crystal
Melting point (°C): 110
Storage Temperature: <0°C
Catalog Number: TCA2523-100MG
Supplier: TCI America

SDS Certificates


Image Unavailable-TCF0542-5G

4-Formylphenyl-β-D-allopyranoside ≥98.0% (by HPLC)

Description: CAS Number: 80154-34-3
Molecular Formula: C13H16O7
Molecular Weight: 284.26
Purity/Analysis Method: >98.0% (HPLC)
Form: Crystal
Melting point (°C): 190
Catalog Number: TCF0542-5G
Supplier: TCI America

SDS


Image Unavailable-TCF1086-25G

6-Fluorochromane-2-carboxylic acid ≥98.0% (by GC, titration analysis)

Description: 6-Fluorochroman-2-carboxylic Acid, Purity: >98.0%(GC)(T), CAS Number: 99199-60-7, Molecular Formula: C10H9FO3, Molecular Weight: 196.18, Synonyms: 6-Fluoro-3,4-dihydro-2H-1-benzopyran-2-carboxylic Acid, Size: 5G
Catalog Number: TCF1086-25G
Supplier: TCI America
Image Unavailable-TCH1173-5G

2-Hydroxy-5-nitro-3-picoline ≥98.0%

Description: CAS Number: 21901-34-8
Molecular Formula: C6H6N2O3
Molecular Weight: 154.13
Purity/Analysis Method: >98.0% (GC)
Form: Crystal
Melting point (°C): 229
Catalog Number: TCH1173-5G
Supplier: TCI America

SDS


Image Unavailable-CA80053-584

Rat Parathyroid Hormone 1-34

Description: Rat Parathyroid Hormone 1-34
Catalog Number: CA80053-584
Supplier: MilliporeSigma

SDS Certificates


Product Image-470007-312

Pre-Cut Felt Human Body Model

Description: This life-size felt mannequine makes it easier for young kids to visualize the complex inner workings of the human body. Designed under a doctor's direction, this 34-piece set responsibly teaches health, exercise, anatomy and body funtions.
Catalog Number: 470007-312
Supplier: LITTLE FOLKS VISUALS
Image Unavailable-AA87299-AD

Benzylmagnesium chloride 1-2 M in THF

Description: Benzylmagnesium chloride, 1-2M in THF, Cas Number: 6921-34-2, Molecular Formula: C7H7ClMg, Color: Brown to purple, Form: Liquid, Size: 50ML
Catalog Number: AA87299-AD
Supplier: Thermo Scientific Chemicals

SDS Certificates


Image Unavailable-CAHX0607-1

Hydrochloric acid 34 - 37%, OmniTrace® for trace metal analysis, Supelco®

Description: For elemental metal analysis via atomic absorption and ICP instruments. Actual Lot Analysis on label. Color-coded label to match acid cap.
Catalog Number: CAHX0607-1
Supplier: MilliporeSigma

SDS Certificates


Image Unavailable-103007-174

Human GLP-2 (1-34), Glucagon-Like Peptide-2 (1-34)

Description: Glucagon-like peptide-2 (GLP-2) promotes nutrient absorption via expansion of the mucosal epithelium by stimulation of crypt cell proliferation and inhibition of apoptosis in the small intestine. It also reduces epithelial permeability, and decreases meal-stimulated gastric acid secretion and gastrointestinal motility. GLP-2 promotes the expansion of the intestinal epithelium through stimulation of the GLP-2 receptor, a member of the glucagon-secretin G protein-coupled receptor superfamily.
Sequence: HADGSFSDEMNTILDNLAARDFINWLIQTKITDR
MW: 3922.4 Da
% Peak area by HPLC: 95
Storage condition: -20° C
Catalog Number: 103007-174
Supplier: Anaspec Inc
Image Unavailable-TCB4416-100ML

Boron trichloride ∼17% ∼1 mol/L in hexane

Description: Boron Trichloride (ca. 17% in Hexane, ca. 1.0mol/L), Cas number: 10294-34-5, Molecular Formula: BCl3, Molecular Weight: 117.16, Appearance: Colorless - Slightly pale yellow clear liquid, Storage: 0-10 deg C, Size: 100ML
Catalog Number: TCB4416-100ML
Supplier: TCI America

SDS


433 - 448 of 65,239