Print…

You Searched For: 3,6-Dibromocarbazole


11,246  results were found

Refine Results Sort by

Sort Results

List View Easy View
SearchResultCount:"11246"

Rate These Search Results

Image Unavailable-76219-608

2,5-Bis(2-ethylhexyl)-3,6-di(2-thienyl)-2,5-dihydropyrrolo[3,4-c]pyrrole-1,4-dione 200MG

Description: 2,5-Bis(2-ethylhexyl)-3,6-di(2-thienyl)-2,5-dihydropyrrolo[3,4-c]pyrrole-1,4-dione, Purity: >98%, CAS: 1185885-86-2, MF: C30H40N2O2S2, MW: 524.78, Form: Crystal- Powder, Yellow - Deep yellow red, Size: 200MG
Catalog Number: 76219-608
Supplier: TCI America
Image Unavailable-TCD3969-1G

3,6-Di(2-Thienyl)-2,5-Dihydropyrrolo[3,4-C]Pyrrole-1,4-Dione >95.0% (Hplc)(N)

Description: , 850583-75-4, C14H8N2O2S2, 300.35
Catalog Number: TCD3969-1G
Supplier: TCI America

SDS Certificates


Image Unavailable-TCD3969-5G

3,6-Di(2-Thienyl)-2,5-Dihydropyrrolo[3,4-C]Pyrrole-1,4-Dione >95.0% (Hplc)(N)

Description: , 850583-75-4, C14H8N2O2S2, 300.35
Catalog Number: TCD3969-5G
Supplier: TCI America

SDS Certificates


Image Unavailable-TCD0595-500G

, 7153-21-1, C10H8O8S2, 364.25

Description: , 7153-21-1, C10H8O8S2, 364.25
Catalog Number: TCD0595-500G
Supplier: TCI America

SDS


Image Unavailable-TCD0595-025G

, 7153-21-1, C10H8O8S2, 364.25

Description: , 7153-21-1, C10H8O8S2, 364.25
Catalog Number: TCD0595-025G
Supplier: TCI America

SDS


Image Unavailable-TCB4062-100MG

N-(1r,8s,9s)-Bicyclo[6.1.0]non-4-yn-9-ylmethyloxycarbonyl-1,8-diamino-3,6-dioxaoctane

Description: N-(1r,8s,9s)-Bicyclo[6.1.0]non-4-yn-9-ylmethyloxycarbonyl-1,8-diamino-3,6-dioxaoctane, Purity: >90.0%(HPLC), Cas number: 1263166-93-3, Molecular Formula: C17H28N2O4, Molecular Weight: 324.42, Size: 100MG, 1263166-93-3, C17H28N2O4, 324.42
Catalog Number: TCB4062-100MG
Supplier: TCI America

SDS


Image Unavailable-TCB4062-25MG

N-(1r,8s,9s)-Bicyclo[6.1.0]non-4-yn-9-ylmethyloxycarbonyl-1,8-diamino-3,6-dioxaoctane

Description: N-(1r,8s,9s)-Bicyclo[6.1.0]non-4-yn-9-ylmethyloxycarbonyl-1,8-diamino-3,6-dioxaoctane, Purity: >90.0%(HPLC), Cas number: 1263166-93-3, Molecular Formula: C17H28N2O4, Molecular Weight: 324.42, Size: 25MG, 1263166-93-3, C17H28N2O4, 324.42
Catalog Number: TCB4062-25MG
Supplier: TCI America

SDS Certificates


Image Unavailable-TCL0115-250G

L-(-)-LACTIDE

Description: , 4511-42-6, C6H8O4, 144.13
Catalog Number: TCL0115-250G
Supplier: TCI America

SDS Certificates


Image Unavailable-TCL0115-025G

, 4511-42-6, C6H8O4, 144.13

Description: , 4511-42-6, C6H8O4, 144.13
Catalog Number: TCL0115-025G
Supplier: TCI America

SDS Certificates


Image Unavailable-103008-696

GLP-1(9-36) 1mg

Description: GLP-1(9-36), human, amide, Purity: Greater than or equal to 95% (HPLC), Molecular weight: 3089.5, Sequence: EGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2, Appearance: Powder, rapid degradation of GLP-1 (7-36)amide, by enzyme dipeptidyl peptidase IV (DPP-4), Storage: -20 degree C, Size: 1mg
Catalog Number: 103008-696
Supplier: Anaspec Inc
Image Unavailable-H-8585.1000BA

PEPTIDE YY (3-36) (HUMAN)

Description: 1mg PYY (3-36), a Y2 receptor agonist, is released from the body's gastrointestinal tract in proportion to caloric intake. It has been shown that peripheral injection of PYY (3-36) in rats inhibited food intake and reduced weight gain. In addition, infusion of PYY (3-36) in humans significantly decreased appetite and reduced food intake by 33% over 24h, which sug gests that PYY (3-36) has a role in 'longer term' regulation of food intake. Thus, the PYY (3-36) may represent a lead compound for the development of drug s for the treatment of obesity. CAS: 123583-37-9 C180H279N53O54 FW: 4049.52 . Synonym: PYY (3-36) (human)
Catalog Number: H-8585.1000BA
Supplier: Bachem Americas
Image Unavailable-H-8585.0500BA

PEPTIDE YY (3-36) (HUMAN)

Description: 0.5mg PYY (3-36), a Y2 receptor agonist, is released from the body's gastrointestinal tract in proportion to caloric intake. It has been shown that peripheral injection of PYY (3-36) in rats inhibited food intake and reduced weight gain. In addition, infusion of PYY (3-36) in humans significantly decreased appetite and reduced food intake by 33% over 24h, which sug gests that PYY (3-36) has a role in 'longer term' regulation of food intake. Thus, the PYY (3-36) may represent a lead compound for the development of drug s for the treatment of obesity. CAS: 123583-37-9 C180H279N53O54 FW: 4049.52 . Synonym: PYY (3-36) (human)
Catalog Number: H-8585.0500BA
Supplier: Bachem Americas
Image Unavailable-TCB4357-1G

1-tert-Butoxycarbonyl-1,2,3,6-tetrahydropyridine 1G

Description: 1-tert-Butoxycarbonyl-1,2,3,6-tetrahydropyridine, Purity: >97.0%(GC), Cas: 85838-94-4, Molecular Formula: C10H17NO2, MW: 183.25, Synonyms: 1-Boc-1,2,3,6-tetrahydropyridine, tert-Butyl 1,2,3,6-Tetrahydropyridine-1-carboxylate, Size: 1G
Catalog Number: TCB4357-1G
Supplier: TCI America

SDS


Image Unavailable-102996-564

Human Peptide YY (3-36)

Description: Human Peptide YY (3-36)
Catalog Number: 102996-564
Supplier: Anaspec Inc
Product Image-76576-438

ELISA KIT HUMAN INTERLEUKIN 36 IL-36

Catalog Number: 76576-438
Supplier: AFG Bioscience
Image Unavailable-103006-340

Apelin - 36 human 1 mg

Description: Apelin - 36, human, peptide, inhibits infection of APJ-expressing cells by a diverse group of primary HIV-1 viruses, Purity: HPLC >/= 95%, Sequence (One-Letter Code): LVQPRGSRNGPGPWQGGRRKFRRQRPRLSHKGPMPF, MW: 4195.9, Physical State: Powder, Storage: -20 degree C, Size: 1 mg
Catalog Number: 103006-340
Supplier: Anaspec Inc
177 - 192 of 11,246