Print…

You Searched For: Diagnostic+Biosystems


70,214  results were found

Refine Results Sort by

Sort Results

List View Easy View
SearchResultCount:"70214"

Rate These Search Results

Product Image-470015-404

Ward's® Crystal Form Collection

Description: Basic Set of Natural Crystals
Catalog Number: 470015-404
Supplier: Avantor
Product Image-470149-482

Flask Form Electroscope

Description: This inexpensive device detects and estimates charges.
Catalog Number: 470149-482
Supplier: Shiv Dial Sud & Sons
Image Unavailable-470179-596

Ward's® Bacteria Forms Mixture

Description: Three Morphology Types in One Tube
Catalog Number: 470179-596
Supplier: Avantor
Image Unavailable-H-2355.0025BA

Bovine beta-Casomorphin (1-4) amide Acetate

Description: Besides deltorphins, dermorphins, dynorphins, enkephalins and endorphins, Bachem offers opioid peptides such as acetalins, BAM peptides, α-casein and gluten exorphins, endomorphins, kyotorphins, metorphamide, opiorphins, δ opioid receptor antagonists, and valorphin.
Catalog Number: H-2355.0025BA
Supplier: Bachem Americas
Product Image-80066-230

Drechel Gas Washing Bottles, Tall Form, Chemglass

Description: Tall form gas washing bottle having a standard taper 34/28 top joint, hex base, and plain tube for gas dispersion.
Catalog Number: 80066-230
Supplier: Chemglass

Small Business Enterprise


Product Image-CA82022-842

Photoreactive Cross Linkers, G-Biosciences

Description: G-Biosciences’ cross-linking agents contain at least two reactive groups that are reactive towards numerous groups, including sulfhydryls, amines and carbohydrates, and create chemical covalent bonds between two or more molecules. Functional groups that can be targeted with cross-linking agents are primary amines, carboxyls, sulfhydryls, carbohydrates and carboxylic acids. Protein molecules have many of these functional groups and therefore proteins and peptides can be readily conjugated using cross-linking agents.
Catalog Number: CA82022-842
Supplier: G-Biosciences
Product Image-34623-300

VWR® Specific Gravity/Relative Density Plain Form Hydrometers, Traceable to NIST

Description: These plain form hydrometers are available in a variety of models measuring specific gravity/relative density (g/cm³) of liquids lighter and heavier than water in various ranges from 0.690 to 3.000.
Catalog Number: 34623-300
Supplier: VWR International

Certificates


Image Unavailable-103008-696

Human GLP-1(9-36), amide

Description: GLP-1 (9-36) is the result of the rapid degradation of GLP-1 (7-36)amide, by the enzyme dipeptidyl peptidase IV (DPP-4), which is widely expressed in a number of sites, including the endothelial cells of small gut arterioles. GLP-1 (9-36) accounts for the majority of GLP-1 that reaches the system circulation. Whereas GLP-1 (7-36) amide stimulates glucose-dependent insulin secretion and inhibits glucagon secretion, GLP-1(9-36)amide administration had no effect on glucose clearance or insulin secretion in humans. GLP-1(9-36)amide however was shown to exert cardioprotective actions in rodent hearts.
Sequence: EGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2
MW: 3089.5 Da
% Peak area by HPLC: 95
Storage condition: -20° C
Catalog Number: 103008-696
Supplier: Anaspec Inc
Product Image-CAJTC789-07

J.T.Baker® BAKERBOND® PROchievA™, Recombinant Protein A Resin, Affinity Chromatography Columns

Description: The J.T.Baker® BAKERBOND® PROchievA™ recombinant protein A resin offers superior dynamic binding capacity with excellent alkaline stability linked to Avantor's proprietary ligand.
Catalog Number: CAJTC789-07
Supplier: AVANTOR PERFORMANCE MATERIAL LLC

Certificates


Product Image-83008-854

VITLAB® Short-Form Graduated Cylinders, Polypropylene, BrandTech

Description: Made of translucent, chemically-resistant polypropylene.
Catalog Number: 83008-854
Supplier: Brandtech
Product Image-89057-574

Flask, Dewar, Low Form, Ace Glass Incorporated

Description: This cylindrical, low form flask is silvered and evacuated
Catalog Number: 89057-574
Supplier: Ace Glass

Small Business Enterprise


Image Unavailable-30618-540

PRP-C18 Bulk Resin, Hamilton Company

Description: Packing material for reversed phase applications.
Catalog Number: 30618-540
Supplier: Hamilton
Image Unavailable-H-5964.0500BA

Human pTH (1-34) amide Trifluoroacetate

Description: See also the pTH2 receptor agonist TIP39 (H-4878).
Catalog Number: H-5964.0500BA
Supplier: Bachem Americas
Image Unavailable-CA71003-226

Biotin Resin for Isolation of Avidin, Streptavidin & Neutravidin Coupled Molecules, G-Biosciences

Description: G-Biosciences' Immobilized Biotin Resin is designed for the high affinity chromatography purifications of avidin, streptavidin and Neutravidin protein.
Catalog Number: CA71003-226
Supplier: G-Biosciences

SDS


Image Unavailable-AA46882-A1

Sepabeads® SP825L synthetic adsorbent resin poly(styrene-divinylbenzene) P.R. 70 angstroms, highly porous type

Description: Sepabeads SP825L is used in amino acid separations, small molecules in medium hydrophobicity in polar solvents.
Catalog Number: AA46882-A1
Supplier: Thermo Scientific Chemicals

SDS Certificates


Image Unavailable-A-4320.0001BA

N-Boc-N'-Fmoc-diaminoacetic acid

Description: Sequence: Fmoc-α-amino-DL-Gly(Boc)-OH
Catalog Number: A-4320.0001BA
Supplier: Bachem Americas
129 - 144 of 70,214