You Searched For: 3,4-Methylenedioxycinnamic+acid


68,856  results were found

SearchResultCount:"68856"

Sort Results

List View Easy View

Rate These Search Results

Catalog Number: (TCA0540-025G)
Supplier: TCI America
Description: CAS Number: 137-66-6
MDL Number: MFCD00005377
Molecular Formula: C22H38O7
Molecular Weight: 414.54
Purity/Analysis Method: >97.0% (T)
Form: Crystal
Melting point (°C): 114
Specific rotation [a]20/D: 22.5 deg (C=1, EtOH)

Supplier: TCI America
Description: CAS Number: 89-65-6
MDL Number: MFCD00005378
Molecular Formula: C6H8O6
Molecular Weight: 176.12
Purity/Analysis Method: >98.0% (T)
Form: Crystal
Melting point (°C): 167
Specific rotation [a]20/D: -17.5 deg (C=10, H2O)
Supplier: Thermo Scientific Chemicals
Description: 3-(4-Chlorophenyl)propionic acid 94%
Catalog Number: (10073-032)
Supplier: Prosci
Description: IL-34 is a homodimeric cytokine that is expressed in a range of tissues including spleen, heart, brain, liver, kidney, lung, ovary, thymus, testis, small intestine, prostate and colon. IL-34 is a ligand for colony-stimulating factor-1 receptor (CSF1R), which also binds to CSF-1. It specifically binds CD14+ monocytes, promotes survival and proliferation of human peripheral blood monocytes, and stimulates macrophage colony formation by human bone marrow cells. IL-34, like human CSF-1 stimulates phosphorylation of MAPK1/ERK2 and MAPK3/ERK1. Recombinant human IL-34 is a 52.5 kDa homodimeric glycoprotein consisting of 460 amino acid residues, including a C-terminal His-Tag.


Supplier: Bachem Americas
Description: See also the pTH2 receptor agonist TIP39 (H-4878).

Supplier: Thermo Scientific Chemicals
Description: 2,3-Dimethylphenylboronic acid 98%

Catalog Number: (CAAAJ66442-06)
Supplier: Thermo Scientific Chemicals
Description: 2,3-O-Isopropylidene-D-ribonic acid-1,4-lactone, 97+%. Powder.

Supplier: Thermo Scientific Chemicals
Description: 2,4-Dimethoxyphenylboronic acid 98%
Supplier: Thermo Scientific Chemicals
Description: 4,5-Dimethoxy-2-nitrobenzoic acid 98%
Supplier: Spectrum Chemicals
Description: Ascorbic Acid, Crystalline Powder, FCC is commonly used as antioxidant food additive. Spectrum Chemical offers over 300 Food Grade (FCC) chemical ingredients packaged in laboratory size bottles to production drum quantities and are manufactured, packaged and stored under current Good Manufacturing Practices (cGMP) per 21CFR part 211 in FDA registered and inspected facilities.
Supplier: Thermo Scientific Chemicals
Description: 1,4-Benzodioxane-6-boronic acid 97%
Supplier: TCI America
Description: CAS Number: 61-19-8
MDL Number: MFCD00005750
Molecular Formula: C10H14N5O7P
Molecular Weight: 347.22
Purity/Analysis Method: >98.0% (HPLC,T)
Form: Crystal
Melting point (°C): 200
Supplier: Bachem Americas
Description: Sequence: Fmoc-Dap-OH

Supplier: TCI America
Description: [Optical Resolving]
CAS Number: 17257-71-5
MDL Number: MFCD00064200
Molecular Formula: C10H9F3O3
Molecular Weight: 234.17
Purity/Analysis Method: >98.0% (GC,T)
Form: Crystal
Flash Point (°C): 113
Freezing point (°C): 34
Specific rotation [a]20/D: -72 deg (C=2, MeOH)
Catalog Number: (103007-174)
Supplier: Anaspec Inc
Description: Glucagon-like peptide-2 (GLP-2) promotes nutrient absorption via expansion of the mucosal epithelium by stimulation of crypt cell proliferation and inhibition of apoptosis in the small intestine. It also reduces epithelial permeability, and decreases meal-stimulated gastric acid secretion and gastrointestinal motility. GLP-2 promotes the expansion of the intestinal epithelium through stimulation of the GLP-2 receptor, a member of the glucagon-secretin G protein-coupled receptor superfamily.
Sequence: HADGSFSDEMNTILDNLAARDFINWLIQTKITDR
MW: 3922.4 Da
% Peak area by HPLC: 95
Storage condition: -20° C


Catalog Number: (TCE0667-1G)
Supplier: TCI America
Description: CAS Number: 346656-34-6
Molecular Formula: C14H19BO4
Molecular Weight: 262.11
Purity/Analysis Method: >98.0% (T)
Form: Clear Liquid
Specific Gravity (20/20): 1.09
Storage Temperature: 0-10°C

Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
You must log in to order restricted items. We request that you provide the required business documentation to purchase this product for the first time.

To order chemicals, medical devices, or other restricted products please provide identification that includes your business name and shipping address via email CMD_NA@vwr.com or fax 484.881.5997 referencing your VWR account number . Acceptable forms of identification are:

  • issued document with your organization's Federal Tax ID Number
  • Government issued document with your organization's Resale Tax ID Number
  • Any other Government ID that includes the business name and address


VWR will not lift restrictions for residential shipping addresses.

-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is currently unavailable but limited stock may be available in our extended warehouse network. Please call 1-800-932-5000 and a VWR Customer Service Representative will help you.
241 - 256 of 68,856
no targeter for Bottom