You Searched For: 3,4-Dimethoxyaniline


4,482  results were found

SearchResultCount:"4482"

Sort Results

List View Easy View

Rate These Search Results

Catalog Number: (ABCA_AB95571-100UG)
Supplier: Abcam
Description: PE Mouse monoclonal [34-1-2S] to MHC class I.

New Product


Supplier: Abcam
Description: Rabbit monoclonal [EPR19089-34] to MEF2A + MEF2C - BSA and Azide free.

New Product

Supplier: Abcam
Description: Rabbit monoclonal [EPR16259-34] to Cubilin - C-terminal.

New Product

Supplier: TCI America
Description: 6-Fluorochroman-2-carboxylic Acid, Purity: >98.0%(GC)(T), CAS Number: 99199-60-7, Molecular Formula: C10H9FO3, Molecular Weight: 196.18, Synonyms: 6-Fluoro-3,4-dihydro-2H-1-benzopyran-2-carboxylic Acid, Size: 5G

Supplier: Thermo Scientific Chemicals
Description: 4-Nitro-o-xylene 99%

Supplier: Bachem Americas
Description: Adropin is a secreted factor involved in energy homeostasis and lipid metabolism. It is encoded by the energy homeostasis associated gene (Enho) and is expressed in liver and brain. In diet-induced obesity (DIO) mice Adropin (34-76) attenuated hepatosteatosis and insulin reistance independently of adiposity or food intake. Additionally, adropin could be a regulator of endothelial function.

SDS

Catalog Number: (ABCA_AB306412-100U)
Supplier: Abcam
Description: PE Rabbit monoclonal [EPR5118-34] to Amyloid Precursor Protein.

New Product


Catalog Number: (103007-174)
Supplier: Anaspec Inc
Description: Glucagon-like peptide-2 (GLP-2) promotes nutrient absorption via expansion of the mucosal epithelium by stimulation of crypt cell proliferation and inhibition of apoptosis in the small intestine. It also reduces epithelial permeability, and decreases meal-stimulated gastric acid secretion and gastrointestinal motility. GLP-2 promotes the expansion of the intestinal epithelium through stimulation of the GLP-2 receptor, a member of the glucagon-secretin G protein-coupled receptor superfamily.
Sequence: HADGSFSDEMNTILDNLAARDFINWLIQTKITDR
MW: 3922.4 Da
% Peak area by HPLC: 95
Storage condition: -20° C


Supplier: Bachem Americas
Description: See also the pTH2 receptor agonist TIP39 (H-4878).

Catalog Number: (TCD4908-1G)
Supplier: TCI America
Description: 6,7-Dimethyl-1-tetralone, Purity: >98.0%(GC), CAS Number: 19550-57-3, Molecular Formula: C12H14O, Molecular Weight: 174.24, Synonyms: 3,4-Dihydro-6,7-dimethyl-1(2H)-naphthalenone, Size: 1G


Catalog Number: (TCC2087-5G)
Supplier: TCI America
Description: CAS Number: 52944-34-0
MDL Number: MFCD00270099
Molecular Formula: C9H11Cl
Molecular Weight: 154.64
Purity/Analysis Method: >98.0% (GC)
Form: Clear Liquid
Boiling point (°C): 203
Specific Gravity (20/20): 1.02

SDS


Supplier: TCI America
Description: Carteolol Hydrochloride, CAS Number: 51781-21-6, Purity: 98.0%, Molecular Formula: C16H24N2O3.HCl, Molecular Weight: 328.84, Synonyms: 5-[3-[(1,1-Dimethylethyl)amino]-2-hydroxypropoxy]-3,4-dihydro-2(1H)-quinolinone Hydrochloride, Physical Form: Solid, Size: 250MG

SDS

Supplier: AVANTOR PERFORMANCE MATERIAL LLC
Description: Fine granules. 20 to 80 mesh.
Supplier: Abcam
Description: Rabbit monoclonal [EPR22043-34] to H6PD/GDH - BSA and Azide free (Detector).

New Product

Supplier: Abcam
Description: Alexa Fluor® 488 Rabbit monoclonal [EPR26207-34] to TREM1.

New Product

Supplier: Abcam
Description: Alexa Fluor® 555 Rabbit monoclonal [EPR26207-34] to TREM1.

New Product

Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
You must log in to order restricted items. We request that you provide the required business documentation to purchase this product for the first time.

To order chemicals, medical devices, or other restricted products please provide identification that includes your business name and shipping address via email CMD_NA@vwr.com or fax 484.881.5997 referencing your VWR account number . Acceptable forms of identification are:

  • issued document with your organization's Federal Tax ID Number
  • Government issued document with your organization's Resale Tax ID Number
  • Any other Government ID that includes the business name and address


VWR will not lift restrictions for residential shipping addresses.

-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is currently unavailable but limited stock may be available in our extended warehouse network. Please call 1-800-932-5000 and a VWR Customer Service Representative will help you.
753 - 768 of 4,482
no targeter for Bottom