Print…

You Searched For: 3,4-Difluorobenzaldehyde


4,479  results were found

Refine Results Sort by
SearchResultCount:"4479"

Sort Results

List View Easy View

Rate These Search Results

Product Image-ABCA_AB191074-100U

Anti-Cubilin Rabbit Monoclonal Antibody [clone: EPR16259-34]

Supplier: Abcam
Description: Rabbit monoclonal [EPR16259-34] to Cubilin - C-terminal.

New Product

Image Unavailable-102996-410

Human Parathyroid Hormone (1-34)-Lys(Biotin), Biotin

Catalog Number: (102996-410)
Supplier: Anaspec Inc
Description: Parathyroid hormone (PTH) regulates the metabolism of calcium and phosphate. PTH and PTH-related polypeptide (PTHrP) play important roles in calcium homeostasis of bone, kidney, breast, and placenta; they signal via the PTH/PTHrP and PTH2 receptors. PTH(1–34) administration suppresses cardiovascular calcification and down-regulates aortic osteogenic programs driven by diabetes and dyslipidemia.
Sequence: SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNFK(Biotin)
MW: 4472.2 Da
% Peak area by HPLC: 95
Storage condition: -20° C
Image Unavailable-CAAAH59634-03

(2R,3R,4S,5R)-2-(6-Chloro-9H-purin-9-yl)-5-(hydroxymethyl)tetrahydrofuran-3,4-diol 98%

Supplier: Thermo Scientific Chemicals

Certificates

Image Unavailable-89366-134

Anti-CD1A Mouse Monoclonal Antibody [clone: NA1/34-HLK]

Catalog Number: (89366-134)
Supplier: Genetex
Description: Mouse monoclonal antibody [NA1/34-HLK] to CD1a
Product Image-89044-788

Accessories for Socorex™ Calibrex™ 521 digital Bottle Top Dispensers, DWK Life Sciences

Catalog Number: (89044-788)
Supplier: DWK Life Sciences (KIMBLE)
Description: threaded, 34 mm OD

Small Business Enterprise


Image Unavailable-CAAAJ63786-MD

Methyl caffeate

Supplier: Thermo Scientific Chemicals
Description: Inhibitor of protein tyrosine kinase

Certificates

Image Unavailable-75834-694

Single-Component Explosives Solutions, Restek

Catalog Number: (75834-694)
Supplier: Restek
Description: Standard Surrogate (3,4-Dinitrotoluene) 8095, CAS no: 610-39-9, Concentration: 1,000 ug/mL in methanol, Shelf Life: 6 Months, Storage: 10 deg C or colder, Volume: 1 mL/ampule
Image Unavailable-CA80054-862

Tyrphostin AG 490 ≥98% (by HPLC), Calbiochem®

Catalog Number: (CA80054-862)
Supplier: MilliporeSigma
Description: AG 538 inhibitors are potent, cell-premeable, reversible, and competitive inhibitor of IGF-1 receptor kinase

Certificates


Image Unavailable-TCD1436-010G

1,2-Dichloro-4-iodobenzene ≥98.0%

Catalog Number: (TCD1436-010G)
Supplier: TCI America
Description: CAS Number: 20555-91-3
MDL Number: MFCD00019014
Molecular Formula: C6H3Cl2I
Molecular Weight: 272.89
Purity/Analysis Method: >98.0% (GC)
Form: Crystal
Flash Point (°C): 110
Freezing point (°C): 30

SDS


Image Unavailable-89365-700

Anti-CD2 Mouse Monoclonal Antibody [clone: MRC OX-34]

Catalog Number: (89365-700)
Supplier: Genetex
Description: Mouse monoclonal [MRC OX-34] to rat CD2 (FITC)
Image Unavailable-CA10760-844

Anti-IL-34 Mouse Monoclonal Antibody [clone: E0320E7]

Catalog Number: (CA10760-844)
Supplier: Biolegend
Description: Purified anti-human IL-34 [E0320E7]; Isotype: Mouse IgG2b, λ; Reactivity: Human; Apps: ELISA Capture; Size: 500 μg
Image Unavailable-CAAAA17257-06

3',4'-Difluoropropiophenone 97%

Catalog Number: (CAAAA17257-06)
Supplier: Thermo Scientific Chemicals
Description: 3',4'-Difluoropropiophenone 97%

Certificates


Image Unavailable-89295-536

Anti-VTN Mouse Monoclonal Antibody [clone: 615-1E9-34]

Catalog Number: (89295-536)
Supplier: Genetex
Description: Mouse Monoclonal antibody to vitronectin [615-1E9-34]
Image Unavailable-CA10761-900

Anti-IL-34 Goat Polyclonal Antibody (Biotin) [clone: Poly5193]

Catalog Number: (CA10761-900)
Supplier: Biolegend
Description: Biotin anti-mouse IL-34 [Poly5193]; Isotype: Goat Polyclonal Ig; Reactivity: Mouse; Apps: ELISA Detection; Size: 50 μg
Image Unavailable-H-6686.1000BA

Human;Mouse;Rat Adropin (34-76) Trifluoroacetate

Supplier: Bachem Americas
Description: Adropin is a secreted factor involved in energy homeostasis and lipid metabolism. It is encoded by the energy homeostasis associated gene (Enho) and is expressed in liver and brain. In diet-induced obesity (DIO) mice Adropin (34-76) attenuated hepatosteatosis and insulin reistance independently of adiposity or food intake. Additionally, adropin could be a regulator of endothelial function.

SDS

Product Image-77520-784

Mouse IL34 (Interleukin 34) ELISA Kit

Catalog Number: (77520-784)
Supplier: AFG Bioscience
Description: Mouse IL34 (Interleukin 34) ELISA Kit
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
You must log in to order restricted items. We request that you provide the required business documentation to purchase this product for the first time.

To order chemicals, medical devices, or other restricted products please provide identification that includes your business name and shipping address via email CMD_NA@vwr.com or fax 484.881.5997 referencing your VWR account number . Acceptable forms of identification are:

  • issued document with your organization's Federal Tax ID Number
  • Government issued document with your organization's Resale Tax ID Number
  • Any other Government ID that includes the business name and address


VWR will not lift restrictions for residential shipping addresses.

-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is currently unavailable but limited stock may be available in our extended warehouse network. Please call 1-800-932-5000 and a VWR Customer Service Representative will help you.
705 - 720 of 4,479
no targeter for Bottom