Print…

You Searched For: Capric+acid


101,025  results were found

Refine Results Sort by

Sort Results

List View Easy View
SearchResultCount:"101025"

Rate These Search Results

Image Unavailable-TCF0626-5G

(S)-2-((((9H-Fluoren-9-yl)methoxy)carbonyl)amino)-5-ureidopentanoic acid ≥98.0% (by HPLC)

Description: CAS Number: 133174-15-9
MDL Number: MFCD00151943
Molecular Formula: C21H23N3O5
Molecular Weight: 397.43
Purity/Analysis Method: >98.0% (HPLC)
Form: Crystal
Specific rotation [a]20/D: -10 deg (C=1, DMF)
Catalog Number: TCF0626-5G
Supplier: TCI America

SDS


Image Unavailable-TCF0594-1G

N-[(9H-Fluoren-9-ylmethoxy)carbonyl]-D-methionine ≥98.0% (by HPLC, titration analysis)

Description: CAS Number: 112883-40-6
MDL Number: MFCD00062958
Molecular Formula: C20H21NO4S
Molecular Weight: 371.45
Purity/Analysis Method: >98.0% (HPLC,T)
Form: Crystal
Melting point (°C): 132
Specific rotation [a]20/D: 30 deg (C=1, DMF)
Catalog Number: TCF0594-1G
Supplier: TCI America

SDS Certificates


Image Unavailable-TCB4619-1G

(R)-2-((((9H-Fluoren-9-yl)methoxy)carbonyl)amino)-4-(tert-butoxy)-4-oxobutanoic acid ≥98.0% (by HPLC, titration analysis)

Description: CAS Number: 112883-39-3
MDL Number: MFCD00077050
Molecular Formula: C23H25NO6
Molecular Weight: 411.45
Purity/Analysis Method: >98.0% (HPLC,T)
Form: Crystal
Melting point (°C): 149
Specific rotation [a]20/D: 25 deg (C=1, DMF)
Catalog Number: TCB4619-1G
Supplier: TCI America

SDS


Image Unavailable-TCF0443-5G

N-[(9H-Fluoren-9-ylmethoxy)carbonyl]-4-nitro-L-phenylalanine ≥98.0% (by HPLC, titration analysis)

Description: CAS Number: 95753-55-2
MDL Number: MFCD00057810
Molecular Formula: C24H20N2O6
Molecular Weight: 432.43
Purity/Analysis Method: >98.0% (HPLC,T)
Form: Crystal
Specific rotation [a]20/D: -40 deg (C=1, DMF)
Catalog Number: TCF0443-5G
Supplier: TCI America

SDS


Image Unavailable-TCF0592-1G

N-[(9H-Fluoren-9-ylmethoxy)carbonyl]-D-aspartic acid ≥98.0% (by HPLC, titration analysis)

Description: CAS Number: 136083-57-3
MDL Number: MFCD01318740
Molecular Formula: C19H17NO6
Molecular Weight: 355.35
Purity/Analysis Method: >98.0% (HPLC,T)
Form: Crystal
Specific rotation [a]20/D: 29 deg (C=1, DMF)
Catalog Number: TCF0592-1G
Supplier: TCI America

SDS


Image Unavailable-102997-404

Kemptide, FAM (Carboxyfluorescein)

Description: Kemptide is a phosphate acceptor peptide that serves as a synthetic substrate for PKA (Km = 16 µM). The corresponding fluorescent and biotinylated peptides are also proven to be good substrates for PKA.
Sequence:5-FAM-LRRASLG
MW:1130.2 Da
% peak area by HPLC:95
Storage condition:-20° C
Catalog Number: 102997-404
Supplier: Anaspec Inc
Image Unavailable-M-2115.0001BA

Abz-Arg-Val-Lys-Arg-Gly-Leu-Ala-m-nitro-Tyr-Asp-OH Trifluoroacetate

Description: This internally quenched fluorogenic peptide substrate contains anthranilic acid as fluorescent donor and m-nitro-tyrosine as acceptor (quencher). The sequence Abz-RVKRGLAY(NO₂)E is based on the sequence of hemagglutinin. The FRET substrate is efficiently cleaved by furin, a subtilisin-like eukaryotic serine endoprotease with Km = 3.8 µM and kcat = 29.3 s⁻¹ (kcat/Km = 7'710'000 M⁻¹s⁻¹). Its kcat/Km value is over 2000-fold higher than that of the commonly used substrate Boc-Arg-Val-Arg-Arg-AMC (I-1645). FRET Substrate for the basic residue-specific yeast aspartyl protease yapsin 1.
Catalog Number: M-2115.0001BA
Supplier: Bachem Americas
Image Unavailable-102996-536

Human beta-Endorphin

Description: β-Endorphin is an endogenous opioid neuropeptide found in the neurons of both the central and peripheral nervous system.
Sequence:YGGFMTSEKSQTPLVTLFKNAIIKNAYKKGE
MW:3465.1 Da
% peak area by HPLC:95
Storage condition:-20° C
Catalog Number: 102996-536
Supplier: Anaspec Inc
Image Unavailable-TCF0308-001G

Nɑ-[(9H-Fluoren-9-ylmethoxy)carbonyl]-L-glutamine ≥98.0% (by HPLC)

Description: CAS Number: 71989-20-3
MDL Number: MFCD00037137
Molecular Formula: C20H20N2O5
Molecular Weight: 368.39
Purity/Analysis Method: >98.0% (HPLC)
Form: Crystal
Specific rotation [a]20/D: -18 deg (C=1, DMF)
Catalog Number: TCF0308-001G
Supplier: TCI America

SDS


Image Unavailable-TCF0456-1G

N-[(9H-Fluoren-9-ylmethoxy)carbonyl]-L-tyrosine ≥95.0% (by titrimetric analysis)

Description: CAS Number: 92954-90-0
MDL Number: MFCD00134890
Molecular Formula: C24H21NO5
Molecular Weight: 403.43
Purity/Analysis Method: >95.0% (T)
Form: Crystal
Specific rotation [a]20/D: -22 deg (C=1, DMF)
Catalog Number: TCF0456-1G
Supplier: TCI America

SDS


Image Unavailable-TCF0669-1G

N-[(9H-Fluoren-9-ylmethoxy)carbonyl]-L-2-phenylglycine ≥98.0% (by HPLC, titration analysis)

Description: CAS Number: 102410-65-1
MDL Number: MFCD00155632
Molecular Formula: C23H19NO4
Molecular Weight: 373.41
Purity/Analysis Method: >98.0% (HPLC,T)
Form: Crystal
Melting point (°C): 176
Specific rotation [a]20/D: 81 deg (C=1, DMF)
Catalog Number: TCF0669-1G
Supplier: TCI America

SDS


Image Unavailable-103006-512

Human PLP

Description: This is amino acid residue 139 to 151 of myelin proteolipid protein (PLP). This peptide is used to induce relapsing-remitting (RR)-EAE model.
Sequence: HCLGKWLGHPDKF
MW: 1537.8 Da
% Peak area by HPLC: 95
Storage condition: -20°C
Catalog Number: 103006-512
Supplier: Anaspec Inc
Image Unavailable-TCF0299-005G

N-Fmoc-L-valine ≥98.0% (by HPLC, titration analysis)

Description: CAS Number: 68858-20-8
MDL Number: MFCD00037124
Molecular Formula: C20H21NO4
Molecular Weight: 339.39
Purity/Analysis Method: >98.0% (HPLC,T)
Form: Crystal
Melting point (°C): 145
Specific rotation [a]20/D: -17.5 deg (C=1, DMF)
Catalog Number: TCF0299-005G
Supplier: TCI America

SDS Certificates


Image Unavailable-TCF0752-5G

N-[(9H-Fluoren-9-ylmethoxy)carbonyl]-S-(triphenylmethyl)-D-cysteine ≥98.0% (by HPLC, titration analysis)

Description: CAS Number: 167015-11-4
MDL Number: MFCD00151922
Molecular Formula: C37H31NO4S
Molecular Weight: 585.72
Purity/Analysis Method: >98.0% (HPLC,T)
Form: Crystal
Melting point (°C): 174
Specific rotation [a]20/D: -18 deg (C=1, THF)
Storage Temperature: 0-10°C
Catalog Number: TCF0752-5G
Supplier: TCI America

SDS Certificates


Image Unavailable-TCF0652-25G

N-[(9H-Fluoren-9-ylmethoxy)carbonyl]-S-(triphenylmethyl)-L-cysteine ≥98.0% (by HPLC, titration analysis)

Description: CAS Number: 103213-32-7
MDL Number: MFCD00038538
Molecular Formula: C37H31NO4S
Molecular Weight: 585.72
Purity/Analysis Method: >98.0% (HPLC,T)
Form: Crystal
Melting point (°C): 175
Specific rotation [a]20/D: 18 deg (C=1, THF)
Catalog Number: TCF0652-25G
Supplier: TCI America

SDS Certificates


Image Unavailable-TCF0453-1G

(S)-2-((((9H-Fluoren-9-yl)methoxy)carbonyl)amino)pentanedioic acid ≥98.0% (by HPLC, titration analysis)

Description: CAS Number: 121343-82-6
MDL Number: MFCD00237657
Molecular Formula: C20H19NO6
Molecular Weight: 369.37
Purity/Analysis Method: >98.0% (HPLC,T)
Form: Crystal
Specific rotation [a]20/D: -22 deg (C=1, DMF)
Catalog Number: TCF0453-1G
Supplier: TCI America

SDS


577 - 592 of 101,025