Print…

You Searched For: 4-Fluorobenzyl+chloride


24,480  results were found

Refine Results Sort by
SearchResultCount:"24480"

Sort Results

List View Easy View

Rate These Search Results

Image Unavailable-75962-228

Mucin 3 Monoclonal antibody 500uL

Catalog Number: (75962-228)
Supplier: Biotium
Description: Mucin 3, Monoclonal antibody, Clone: M3.1, Host: Mouse, Species reactivity: Human, Isotype: IgG2b, kappa, Conjugate: CF647, Immunogen: synthetic peptide of 35 amino acids, SIB35, Synonyms: Intestinal mucin-3A; intestinal mucin-like, Application: IF, Size: 500uL
Image Unavailable-75962-226

Mucin 3 Monoclonal antibody 100uL

Catalog Number: (75962-226)
Supplier: Biotium
Description: Mucin 3, Monoclonal antibody, Clone: M3.1, Host: Mouse, Species reactivity: Human, Isotype: IgG2b, kappa, Conjugate: CF647, Immunogen: synthetic peptide of 35 amino acids, SIB35, Synonyms: Intestinal mucin-3A; intestinal mucin-like, Application: IF, Size: 100uL
Image Unavailable-76119-754

UCHL5IP PAB 100ul

Catalog Number: (76119-754)
Supplier: Bioss
Description: UCHL5IP Polyclonal Antibody, Host: Rabbit, Isotype: IgG, Species: Human, Mouse, Rat, Conjugate: Alexa Fluor 750, Concentration: 1ug/ul, Purification: Purified by Protein, Synonyms: hVPS4, SKD1, SKD1 homolog, SKD2, Application: IHC-P, Immunofluorescence(IHC-P), Size: 100ul
Product Image-89288-556

RB PAB to PLP2

Catalog Number: (89288-556)
Supplier: Genetex
Description: Rabbit Polyclonal antibody to PLP2 (proteolipid protein 2 (colonic epithelium-enriched)) Purity: Protein A Purified total IgG Species Reactivity: Human Dog Tested Applications: WB Pkg Size: 100 ug
Image Unavailable-CA76634-882

CYCLIN D1

Catalog Number: (CA76634-882)
Supplier: Diagnostic Biosystems
Image Unavailable-10421-822

FGFR1OP Antibody

Catalog Number: (10421-822)
Supplier: Bioss
Description: FGFR1OP Polyclonal Antibody, Host: Rabbit , Cy7 Conjugated, Emmission: 743nm/767nm, Isotype: IgG, Species: Human, Mouse, Rat, Synonymns: FGFR1OP; FOP; FR1OP_HUMAN., Application: IF(IHC-P), 100ul
Image Unavailable-10421-816

FGFR1OP Antibody

Catalog Number: (10421-816)
Supplier: Bioss
Description: FGFR1OP Polyclonal Antibody, Host: Rabbit , Cy3 Conjugated, Emmission: 512,550nm/570,615nm, Isotype: IgG, Species: Human, Mouse, Rat, Synonymns: FGFR1OP; FOP; FR1OP_HUMAN., Application: IF(IHC-P), 100ul
Image Unavailable-89352-758

Mouse Monoclonal antibody to Serotonin

Catalog Number: (89352-758)
Supplier: Genetex
Description: Clone: 5HT-H209 Purity: Tissue culture supernatant Species Reactivity: Human, Mouse, Guinea pig, Rat Tested Applications: ICC/IF, IHC-P, IHC-Fr Pkg Size: 100 ul
Image Unavailable-10421-818

FGFR1OP Antibody

Catalog Number: (10421-818)
Supplier: Bioss
Description: FGFR1OP Polyclonal Antibody, Host: Rabbit , Cy5 Conjugated, Emmission: 625,650nm/670nm, Isotype: IgG, Species: Human, Mouse, Rat, Synonymns: FGFR1OP; FOP; FR1OP_HUMAN., Application: IF(IHC-P), 100ul
Image Unavailable-89359-532

Rabbit Polyclonal antibody to GPCR GPR81 (G protein-coupled receptor 81)

Catalog Number: (89359-532)
Supplier: Genetex
Description: Purity: Immunogen affinity purified Species Reactivity: Human Tested Applications: IHC-P Pkg Size: 25 ug
Image Unavailable-103006-558

MCRAMP mouse 1 mg

Catalog Number: (103006-558)
Supplier: Anaspec Inc
Description: MCRAMP, mouse cathelicidin-related antimicrobial peptide (mCRAMP) is the sole murine cathelicidin, Purity: HPLC>/=95%, Sequence (One-Letter Code): GLLRKGGEKIGEKLKKIGQKIKNFFQKLVPQPEQ, Molecular weight: 3878.7, Appearance: Lyophilized white powder, Storage: -20 degree C, Size: 1 mg
Image Unavailable-10770-670

Recombinant Human PlGF-1

Catalog Number: (10770-670)
Supplier: Peprotech
Description: Recombinant Human PlGF-1, 29.7 kDa disulfide-linked homodimeric protein of two 132 amino acid polypeptide chains. Source: E.coli, Cross Reactivity: Human, Mouse, Purity: Greater than 95%, Synonym: Placenta Growth Factor-1, PlGF, PGF, Pack Size: 100UG
Image Unavailable-10770-672

Recombinant Human PlGF-1

Catalog Number: (10770-672)
Supplier: Peprotech
Description: Recombinant Human PlGF-1, 29.7 kDa disulfide-linked homodimeric protein of two 132 amino acid polypeptide chains. Source: E.coli, Cross Reactivity: Human, Mouse, Purity: Greater than 95%, Synonym: Placenta Growth Factor-1, PlGF, PGF, Pack Size: 250UG
Image Unavailable-10770-676

Recombinant Human PlGF-1

Catalog Number: (10770-676)
Supplier: Peprotech
Description: Recombinant Human PlGF-1, 29.7 kDa disulfide-linked homodimeric protein of two 132 amino acid polypeptide chains. Source: E.coli, Cross Reactivity: Human, Mouse, Purity: Greater than 95%, Synonym: Placenta Growth Factor-1, PlGF, PGF, Pack Size: 1MG
Image Unavailable-10770-674

Recombinant Human PlGF-1

Catalog Number: (10770-674)
Supplier: Peprotech
Description: Recombinant Human PlGF-1, 29.7 kDa disulfide-linked homodimeric protein of two 132 amino acid polypeptide chains. Source: E.coli, Cross Reactivity: Human, Mouse, Purity: Greater than 95%, Synonym: Placenta Growth Factor-1, PlGF, PGF, Pack Size: 500UG
Image Unavailable-10770-668

Recombinant Human PlGF-1

Catalog Number: (10770-668)
Supplier: Peprotech
Description: Recombinant Human PlGF-1, 29.7 kDa disulfide-linked homodimeric protein of two 132 amino acid polypeptide chains. Source: E.coli, Cross Reactivity: Human, Mouse, Purity: Greater than 95%, Synonym: Placenta Growth Factor-1, PlGF, PGF, Pack Size: 25UG
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
You must log in to order restricted items. We request that you provide the required business documentation to purchase this product for the first time.

To order chemicals, medical devices, or other restricted products please provide identification that includes your business name and shipping address via email CMD_NA@vwr.com or fax 484.881.5997 referencing your VWR account number . Acceptable forms of identification are:

  • issued document with your organization's Federal Tax ID Number
  • Government issued document with your organization's Resale Tax ID Number
  • Any other Government ID that includes the business name and address


VWR will not lift restrictions for residential shipping addresses.

-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is currently unavailable but limited stock may be available in our extended warehouse network. Please call 1-800-932-5000 and a VWR Customer Service Representative will help you.
1,265 - 1,280 of 24,480
no targeter for Bottom