Print…
Refine Results Sort by

Sort Results

List View Easy View
SearchResultCount:"48202"

Rate These Search Results

Product Image-77713-382

Anti-egfra Rabbit Polyclonal Antibody (Biotin)

Description: Anti-egfra Rabbit Polyclonal Antibody (Biotin)
Catalog Number: 77713-382
Supplier: AFG Bioscience

New Product


Product Image-77713-422

Anti-dharma Rabbit Polyclonal Antibody (Biotin)

Description: Anti-dharma Rabbit Polyclonal Antibody (Biotin)
Catalog Number: 77713-422
Supplier: AFG Bioscience

New Product


Product Image-CA11029-276

Anti-OVA Rabbit Polyclonal Antibody (Biotin)

Description: Anti-Ovalbumin (Hen Egg White) (Rabbit) Antibody Biotin Conjugated - Anti-Ovalbumin Antibody Biotin Conjugated Is Suitable For Both ELISA, And For Western Blotting. In Western Blots Anti-Ovalbumin Detects A Single Band Of The Expected Apparent Molecular Weight.
Catalog Number: CA11029-276
Supplier: Rockland Immunochemical
Image Unavailable-75885-346

Anti-Biotin Mouse Monoclonal Antibody (CF640R) [clone: Hyb8]

Description: This antibody recognizes both the free and protein-conjugated (either soluble or cell bound) form of biotin. This MAb is highly specific to biotin and shows no cross-reaction with other structurally related compounds. It has a very high affinity for biotin and is excellent for use in various amplification techniques. In some applications, localization of biotinylated probes with avidin produces unacceptably high background staining. Anti-biotin antibody may be substituted to decrease this noise.

CF® dyes are Biotium's next-generation fluorescent dyes. CF®640R is a far-red fluorescent dye (Ex/Em 642/662 nm) with excellent brightness, and the best photostabiity among spectrally-similar dyes.
Catalog Number: 75885-346
Supplier: Biotium
Image Unavailable-CA200-4298S

Anti-Biotin Rabbit Polyclonal Antibody (FITC (Fluorescein Isothiocyanate))

Description: Anti-Biotin is suitable for immunomicroscopy and flow cytometry or FACS analysis as well as other antibody based fluorescent assays requiring lot-to-lot consistency.
Catalog Number: CA200-4298S
Supplier: Rockland Immunochemical
Image Unavailable-75885-328

Anti-Biotin Mouse Monoclonal Antibody (CF488A) [clone: Hyb8]

Description: This antibody recognizes both the free and protein-conjugated (either soluble or cell bound) form of biotin. This MAb is highly specific to biotin and shows no cross-reaction with other structurally related compounds. It has a very high affinity for biotin and is excellent for use in various amplification techniques. In some applications, localization of biotinylated probes with avidin produces unacceptably high background staining. Anti-biotin antibody may be substituted to decrease this noise.

CF® dyes are Biotium's next-generation fluorescent dyes. CF®488A is a green fluorescent dye (Ex/Em 490/515 nm) with excellent brightness and photostability. The dye is minimally charged for less non-specific binding. CF®488A also is compatible with super-resolution imaging by TIRF.
Catalog Number: 75885-328
Supplier: Biotium
Image Unavailable-89363-414

Anti-APOC3 Goat Polyclonal Antibody

Description: Biotin-conjugated Goat polyclonal to Apolipoprotein CIII (Biotin)
Catalog Number: 89363-414
Supplier: Genetex
Image Unavailable-77722-331

Anti-CRYGN Rabbit Polyclonal Antibody (Biotin)

Description: Anti-CRYGN Rabbit Polyclonal Antibody (Biotin)
Catalog Number: 77722-331
Supplier: AFG Bioscience

New Product


Image Unavailable-77722-340

Anti-SYNE2 Rabbit Polyclonal Antibody (Biotin)

Description: Anti-SYNE2 Rabbit Polyclonal Antibody (Biotin)
Catalog Number: 77722-340
Supplier: AFG Bioscience

New Product


Image Unavailable-77722-423

Anti-CNOT9 Rabbit Polyclonal Antibody (Biotin)

Description: Anti-CNOT9 Rabbit Polyclonal Antibody (Biotin)
Catalog Number: 77722-423
Supplier: AFG Bioscience

New Product


Image Unavailable-77722-453

Anti-HOXB13 Rabbit Polyclonal Antibody (Biotin)

Description: Anti-HOXB13 Rabbit Polyclonal Antibody (Biotin)
Catalog Number: 77722-453
Supplier: AFG Bioscience

New Product


Product Image-77819-365

Anti-JRK Rabbit Polyclonal Antibody (Biotin)

Description: Anti-JRK Rabbit Polyclonal Antibody (Biotin)
Catalog Number: 77819-365
Supplier: AFG Bioscience

New Product


Product Image-89495-090

Anti-NWSHPQFEK Tag Mouse Monoclonal Antibody [clone: 5A9F9] (Biotin)

Description: THE™ NWSHPQFEK Tag antibody [Biotin], mAb, Mouse recognizes N-terminal and C-terminal Strep II tagged fusion proteins.
Catalog Number: 89495-090
Supplier: Genscript
Image Unavailable-102996-410

Human Parathyroid Hormone (1-34)-Lys(Biotin), Biotin

Description: Parathyroid hormone (PTH) regulates the metabolism of calcium and phosphate. PTH and PTH-related polypeptide (PTHrP) play important roles in calcium homeostasis of bone, kidney, breast, and placenta; they signal via the PTH/PTHrP and PTH2 receptors. PTH(1–34) administration suppresses cardiovascular calcification and down-regulates aortic osteogenic programs driven by diabetes and dyslipidemia.
Sequence: SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNFK(Biotin)
MW: 4472.2 Da
% Peak area by HPLC: 95
Storage condition: -20° C
Catalog Number: 102996-410
Supplier: Anaspec Inc
Image Unavailable-97065-576

Anti-IgG Goat Polyclonal Antibody (Biotin)

Description: Anti-IgG Goat Polyclonal Antibody (Biotin)
Catalog Number: 97065-576
Supplier: Biotium
Image Unavailable-103359-350

Anti-TRF-2 Mouse Monoclonal Antibody (Biotin) [clone: 4A794.15]

Description: The TRF-2 Antibody (4A794.15) [Biotin] from Novus Biologicals is a mouse monoclonal antibody to TRF-2. This antibody reacts with human, mouse, rat. The TRF-2 Antibody (4A794.15) [Biotin] has been validated for the following applications: Western Blot, ELISA, Immunocytochemistry / Immunofluorescence, Immunohistochemistry-Paraffin, Immunohistochemistry-Frozen.
Catalog Number: 103359-350
Supplier: Novus Biologicals
1 - 16 of 48,202