You Searched For: Oxalyl+dichloride

Description: Zinquin is an UV-excitable, blue fluorescent zinc indicator. Zinquin ethyl ester is membrane-permeable and is hydrolyzed into Zinquin free acid once entering cells. Zinc is believed to be involved in the suppression of apoptosis and thought to play important roles in many neural activities.

Catalog Number: 89139-276

Supplier: Biotium

Sale

Description: CAS Number: 26787-75-7
Molecular Formula: C16H15NO5
Molecular Weight: 301.30
Purity/Analysis Method: >98.0% (HPLC,T)
Form: Crystal
Specific rotation [a]20/D: -127 deg (C=10, MeOH)

Catalog Number: TCC2773-25G

Supplier: TCI America

SDS Sale

Description: Pramlintide is the first in the new class of amylinomimetic compounds and is a synthetic analogue of the human hormone Amylin, a 37 amino acid peptide. Pramlintide’s peptide sequence differs from Amylin by replacing proline at postitions 25, 28, and 29. Pramlintide has a disulfide bridge between C2 and C7. For Research Use Only.
Sequence: KCNTATCATQRLANFLVHSSNNFGPILPPTNVGSNTY-NH2 (S-S Bond) acetate salt
MW: 3949.5 Da
% Peak Area by HPLC: ≥ 95%
Storage condition: -20°C

Catalog Number: 103008-246

Supplier: Anaspec Inc

Sale

Description: CAS Number: 9012-76-4
MDL Number: MFCD00161512
Form: Crystal
Color: Slightly Pale Yellow

Catalog Number: TCC2395-500G

Supplier: TCI America

Certificates Sale

Description: EDTA disodium salt dihydrate 99+%

Catalog Number: CAAAAA15161-0B

Supplier: Thermo Scientific Chemicals

Certificates Sale

Description: Sequence: Phenylac-Gly-OH

Catalog Number: F-2625.0001BA

Supplier: Bachem Americas

Sale

Description: MDL: MFCD00015629

Catalog Number: CAAA11846-09

Supplier: Thermo Scientific Chemicals

Certificates Sale

Description: Determine Concentrations of Unknowns

Catalog Number: 470163-086

Supplier: Ward's Science

SDS Sale

Description: TRC (S)-2-Acetamido-5-ureidopentanoic Acid

Catalog Number: 77977-841

Supplier: LGC Standards

New Product Sale

Description: CAS Number: 4166-20-5
MDL Number: MFCD00799462
Molecular Formula: C8H10O4
Molecular Weight: 170.16
Purity/Analysis Method: >97.0% (GC)
Form: Clear Liquid
Boiling point (°C): 243
Flash Point (°C): 113
Specific Gravity (20/20): 1.16

Catalog Number: TCA2192-25G

Supplier: TCI America

SDS Certificates Sale

Description: Concentration after dilution to 1 liter: c(C₁₀H₁₄N₂Na₂O₈ ∙ 2 H₂O) = 0.1 mol/l

Catalog Number: CA1.09992.0001

Supplier: MilliporeSigma

Certificates Sale

Description: Ethylenediaminetetraacetic Acid Dipotassium Salt Dihydrate for Synthesis Cas Number:25102-12-9 100G

Catalog Number: CA8.19040.0025

Supplier: MilliporeSigma

SDS Certificates Sale

Description: MDL: MFCD00003541 Beilstein Registry No.: 1716295 Common Applications: Metal chelator Fieser: 1,373

Catalog Number: CAAAA10713-0B

Supplier: Thermo Scientific Chemicals

Certificates Sale

Description: For 1L standard solution

Catalog Number: BJ38057-1EA

Supplier: Honeywell Research Chemicals

SDS Sale

Description: With bromide ion, catalyzes the liquid-phase auto-oxidation of cresols.

Catalog Number: CAAA15294-36

Supplier: Thermo Scientific Chemicals

Certificates Sale

Description: trans-1,2-Diaminocyclohexane-N,N,N',N'-tetraacetic acid monohydrate 98%

Catalog Number: CAAAAB22928-14

Supplier: Thermo Scientific Chemicals

Certificates Sale