Print…

You Searched For: 2,3-Dimethylphenylboronic+acid


74,615  results were found

Refine Results Sort by
SearchResultCount:"74615"

Sort Results

List View Easy View

Rate These Search Results

Image Unavailable-10483-440

Anti-DCAF11 Rabbit Polyclonal Antibody (HRP (Horseradish Peroxidase))

Catalog Number: (10483-440)
Supplier: Bioss
Description: WD-repeats are motifs that are found in a variety of proteins and are characterized by a conserved core of 40-60 amino acids that commonly form a tertiary propeller structure. While proteins that contain WD-repeats participate in a wide range of cellular functions, they are generally involved in regulatory mechanisms concerning chromatin assembly, cell cycle control, signal transduction, RNA processing, apoptosis and vesicular trafficking. WDR23 (WD-repeat-containing protein 23), also known as GL014 or PRO2389, is a 546 amino acid protein that contains seven WD-repeats. WDR23 is expressed as three isoforms due to alternative splicing events.
Image Unavailable-89520-218

Anti-BOLL Rabbit Polyclonal Antibody

Catalog Number: (89520-218)
Supplier: Abgent
Description: Western Blot: 1:1000
Image Unavailable-103007-210

Human [Asn23]-beta-Amyloid (1-40)

Catalog Number: (103007-210)
Supplier: Anaspec Inc
Description: This peptide is naturally occurring mutant within the beta-amyloid region of b-amyloid protein precursor (APP). This mutation is associated with severe cerebral amyloid beta-protein angiopathy (CAA) in Iowa kindred. The affected individuals share a missense mutation in APP at position 694. This site corresponds to residue 23 of beta-amyloid peptide resulting in substitution of asparagine for aspartic acid.
Sequence: DAEFRHDSGYEVHHQKLVFFAENVGSNKGAIIGLMVGGVV
Molecular Weight: 4328.9 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C
Image Unavailable-CAAAJ62790-06

Vancomycin hydrochloride for molecular biology

Supplier: Thermo Scientific Chemicals
Description: Inhibits bacterial mucopeptide synthesis.

Certificates

Image Unavailable-10483-438

Anti-DCAF11 Rabbit Polyclonal Antibody (FITC (Fluorescein Isothiocyanate))

Catalog Number: (10483-438)
Supplier: Bioss
Description: WD-repeats are motifs that are found in a variety of proteins and are characterized by a conserved core of 40-60 amino acids that commonly form a tertiary propeller structure. While proteins that contain WD-repeats participate in a wide range of cellular functions, they are generally involved in regulatory mechanisms concerning chromatin assembly, cell cycle control, signal transduction, RNA processing, apoptosis and vesicular trafficking. WDR23 (WD-repeat-containing protein 23), also known as GL014 or PRO2389, is a 546 amino acid protein that contains seven WD-repeats. WDR23 is expressed as three isoforms due to alternative splicing events.
Image Unavailable-76108-702

Anti-WDR23 Rabbit Polyclonal Antibody (Alexa Fluor® 680)

Catalog Number: (76108-702)
Supplier: Bioss
Description: WD-repeats are motifs that are found in a variety of proteins and are characterized by a conserved core of 40-60 amino acids that commonly form a tertiary propeller structure. While proteins that contain WD-repeats participate in a wide range of cellular functions, they are generally involved in regulatory mechanisms concerning chromatin assembly, cell cycle control, signal transduction, RNA processing, apoptosis and vesicular trafficking. WDR23 (WD-repeat-containing protein 23), also known as GL014 or PRO2389, is a 546 amino acid protein that contains seven WD-repeats. WDR23 is expressed as three isoforms due to alternative splicing events.
Image Unavailable-10781-730

Human Recombinant FGF-basic (from E. coli)

Supplier: Peprotech
Description: FGF-basic is one of 23 known members of the FGF family. Proteins of this family play a central role during prenatal development, postnatal growth and regeneration of a variety of tissues, by promoting cellular proliferation and differentiation. FGF-basic is a non-glycosylated, heparin-binding growth factor that is expressed in the brain, pituitary, kidney, retina, bone, testis, adrenal gland, liver, monocytes, epithelial cells and endothelial cells. FGF-basic signals through FGFR 1b, 1c, 2c, 3c and 4. Recombinant Human FGF-basic is a 17.2 kDa protein consisting of 154 amino acid residues.

Image Unavailable-10781-734

Human Recombinant FGF-basic (from E. coli)

Supplier: Peprotech
Description: FGF-basic is one of 23 known members of the FGF family. Proteins of this family play a central role during prenatal development, postnatal growth and regeneration of a variety of tissues, by promoting cellular proliferation and differentiation. FGF-basic is a non-glycosylated, heparin-binding growth factor that is expressed in the brain, pituitary, kidney, retina, bone, testis, adrenal gland, liver, monocytes, epithelial cells and endothelial cells. FGF-basic signals through FGFR 1b, 1c, 2c, 3c and 4. Recombinant Human FGF-basic is a 16.4 kDa protein consisting of 146 amino acid residues.

Product Image-75880-540

Tweezers, Surface Mount, Excelta Corp®

Supplier: Excelta
Description: These tools are specifically designed to handle various electronic Surface Mount Devices.

Small Business Enterprise Minority or Woman-Owned Business Enterprise

Product Image-10082-282

Anti-AARS2 Rabbit Polyclonal Antibody

Catalog Number: (10082-282)
Supplier: Proteintech
Description: AARS2(Alanine--tRNA ligase, mitochondrial) is also named as KIAA1270, AARSL, bA444E17.1, AlaRS, AARSL, COXPD8, MTALARS, MT-ALARS and belongs to the class-II aminoacyl-tRNA synthetase family. It catalyzes the attachment of alanine to tRNA(Ala) in a two-step reaction: alanine is first activated by ATP to form Ala-AMP and then transferred to the acceptor end of tRNA(Ala). It also edits incorrectly charged tRNA(Ala) via its editing domain. The full length 107 kDa protein has a transit peptide with 23 amino acids.
Image Unavailable-75789-374

Human Recombinant Poly-Ig Receptor (from Cells)

Catalog Number: (75789-374)
Supplier: Prosci
Description: The human Polymeric Immunoglobulin Receptor (pIgR) is a 100 kDa type I transmembrane glycoprotein. Its precursor is 764 amino acids. It contains an 18 amino acid signal sequence, a 620 amino acid extracellular region, a 23 amino acid transmembrane fragment, and a 103 amino acid cytoplasmic domain. pIgR is synthesized by secretory epithelial cells with five Ig-like domains in extracellular region, and transfer to the basolateral plasma membrane. For IgA and IgM polymers, in addition to alpha-heavy chains and light Ig chains, a short polypeptide named joining chain (J chain) is also contained and required. pIgR can bind larger polymers of IgA (pIgA) and pentameric IgM as a carrier that transports IgA and IgM across epithelium. The receptor-ligand complexes are endocytosed and transcytosed to the apical surface, then proteolytic cleavage of the sixth extracellular domain of pIgR and generate secretory IgA (SIgA), the pIgR fragment is referred to as secretory component (SC). SIgA is a important component of the mucosal immune system. SC is anti-microbial properties and protects SIgA from proteolytic degradation
Image Unavailable-10669-724

Anti-RNF23 Rabbit Polyclonal Antibody

Catalog Number: (10669-724)
Supplier: Bioss
Description: The RING-type zinc finger motif is present in a number of viral and eukaryotic proteins and is made of a conserved cysteine-rich domain that is able to bind two zinc atoms. Proteins that contain this conserved domain are generally involved in the ubiquitination pathway of protein degradation. RNF23 (RING finger protein 23), also known as tripartite motif-containing protein 39 (TRIM39) or testis-abundant finger protein, is a 518 amino acid protein belonging to the TRIM/RBCC family that is known to interact with MOAP1. Ubiquitously expressed and existing as two alternatively spliced isoforms, RNF23 is found at highest levels in spleen, testis, brain, kidney, liver, heart and skeletal muscle. RNF23 typically localizes to cytosol but shifts to mitochondria upon co-localization with MOAP1, a short-lived, pro-apoptotic protein which RNF23 prevents from becoming poly-ubiquitinated and degraded, thereby facilitating apoptosis. RNF23 contains one B box-type zinc finger, a B30.2/SPRY domain and a single RING-type zinc finger.
Image Unavailable-10669-738

Anti-RNF23 Rabbit Polyclonal Antibody (Cy5®)

Catalog Number: (10669-738)
Supplier: Bioss
Description: The RING-type zinc finger motif is present in a number of viral and eukaryotic proteins and is made of a conserved cysteine-rich domain that is able to bind two zinc atoms. Proteins that contain this conserved domain are generally involved in the ubiquitination pathway of protein degradation. RNF23 (RING finger protein 23), also known as tripartite motif-containing protein 39 (TRIM39) or testis-abundant finger protein, is a 518 amino acid protein belonging to the TRIM/RBCC family that is known to interact with MOAP1. Ubiquitously expressed and existing as two alternatively spliced isoforms, RNF23 is found at highest levels in spleen, testis, brain, kidney, liver, heart and skeletal muscle. RNF23 typically localizes to cytosol but shifts to mitochondria upon co-localization with MOAP1, a short-lived, pro-apoptotic protein which RNF23 prevents from becoming poly-ubiquitinated and degraded, thereby facilitating apoptosis. RNF23 contains one B box-type zinc finger, a B30.2/SPRY domain and a single RING-type zinc finger.
Image Unavailable-102996-078

Rat Atrial Natriuretic Peptide (1-28)

Supplier: Anaspec Inc
Description: Rat ANP differs from the human hormone by only one residue at position 12. ANP (1-28) peptide hormone constitutes the first 28 amino acids of the ANP synthesized in the heart of different vertebrates. It plays an important role in the regulation of blood pressure and natriuresis/diuresis. Residues Phe8, Arg14 and the C-terminal sequence of ANP are known to bind to human NPR-A (Natriuretic peptide receptor type A).
Sequence:SLRRSSCFGGRIDRIGAQSGLGCNSFRY (Disulfide bridge: 7-23)
MW:3062.5 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C

Product Image-CA1.09481.0500

Multi Element Standards for ICP, Certipur®, MilliporeSigma

Supplier: MilliporeSigma
Description: Traceable to standard reference material from NIST.

SDS Certificates

Image Unavailable-10669-746

Anti-RNF23 Rabbit Polyclonal Antibody (HRP (Horseradish Peroxidase))

Catalog Number: (10669-746)
Supplier: Bioss
Description: The RING-type zinc finger motif is present in a number of viral and eukaryotic proteins and is made of a conserved cysteine-rich domain that is able to bind two zinc atoms. Proteins that contain this conserved domain are generally involved in the ubiquitination pathway of protein degradation. RNF23 (RING finger protein 23), also known as tripartite motif-containing protein 39 (TRIM39) or testis-abundant finger protein, is a 518 amino acid protein belonging to the TRIM/RBCC family that is known to interact with MOAP1. Ubiquitously expressed and existing as two alternatively spliced isoforms, RNF23 is found at highest levels in spleen, testis, brain, kidney, liver, heart and skeletal muscle. RNF23 typically localizes to cytosol but shifts to mitochondria upon co-localization with MOAP1, a short-lived, pro-apoptotic protein which RNF23 prevents from becoming poly-ubiquitinated and degraded, thereby facilitating apoptosis. RNF23 contains one B box-type zinc finger, a B30.2/SPRY domain and a single RING-type zinc finger.
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
You must log in to order restricted items. We request that you provide the required business documentation to purchase this product for the first time.

To order chemicals, medical devices, or other restricted products please provide identification that includes your business name and shipping address via email CMD_NA@vwr.com or fax 484.881.5997 referencing your VWR account number . Acceptable forms of identification are:

  • issued document with your organization's Federal Tax ID Number
  • Government issued document with your organization's Resale Tax ID Number
  • Any other Government ID that includes the business name and address


VWR will not lift restrictions for residential shipping addresses.

-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is currently unavailable but limited stock may be available in our extended warehouse network. Please call 1-800-932-5000 and a VWR Customer Service Representative will help you.
737 - 752 of 74,615
no targeter for Bottom