Print…

You Searched For: 2,2\'-Dithienyl+disulfide


19,079  results were found

Refine Results Sort by

Sort Results

List View Easy View
SearchResultCount:"19079"

Rate These Search Results

Image Unavailable-103003-052

Amylin (1 - 37) 1 mg

Description: Amylin (1 - 37), human, amide, Purity: HPLC >/- 95%, Molecular Weight: 3903.3, Sequence: KCNTATCATQRLANFLVRSSNNLGPVLPPTNVGSNTY-NH2, Appearance: Lyophilized white powder, Storage: -20 deg C, Size: 1 mg
Catalog Number: 103003-052
Supplier: Anaspec Inc
Image Unavailable-10774-354

Recombinant MURINE MIDKINE

Description: Recombinant MURINE MIDKINE, Animal Free, 13.3 kDa protein containing 120 amino acid residues including five intra-molecular disulfide bonds, MK chemoattracts embryonic neurons, neutrophils and macrophages, Source: E.coli, Purity: >98%, Synonyms: MK, NEGF-220UG
Catalog Number: 10774-354
Supplier: Peprotech
Image Unavailable-10774-358

Recombinant MURINE MIDKINE

Description: Recombinant MURINE MIDKINE, Animal Free, 13.3 kDa protein containing 120 amino acid residues including five intra-molecular disulfide bonds, MK chemoattracts embryonic neurons, neutrophils and macrophages, Source: E.coli, Purity: >98%, Synonyms: MK, NEGF-2250UG
Catalog Number: 10774-358
Supplier: Peprotech
Image Unavailable-10774-362

Recombinant MURINE MIDKINE

Description: Recombinant MURINE MIDKINE, Animal Free, 13.3 kDa protein containing 120 amino acid residues including five intra-molecular disulfide bonds, MK chemoattracts embryonic neurons, neutrophils and macrophages, Source: E.coli, Purity: >98%, Synonyms: MK, NEGF-21MG
Catalog Number: 10774-362
Supplier: Peprotech
Image Unavailable-10774-352

Recombinant MURINE MIDKINE

Description: Recombinant MURINE MIDKINE, Animal Free, 13.3 kDa protein containing 120 amino acid residues including five intra-molecular disulfide bonds, MK chemoattracts embryonic neurons, neutrophils and macrophages, Source: E.coli, Purity: >98%, Synonyms: MK, NEGF-25UG
Catalog Number: 10774-352
Supplier: Peprotech
Image Unavailable-10774-360

Recombinant MURINE MIDKINE

Description: Recombinant MURINE MIDKINE, Animal Free, 13.3 kDa protein containing 120 amino acid residues including five intra-molecular disulfide bonds, MK chemoattracts embryonic neurons, neutrophils and macrophages, Source: E.coli, Purity: >98%, Synonyms: MK, NEGF-2500UG
Catalog Number: 10774-360
Supplier: Peprotech
Image Unavailable-10774-356

Recombinant MURINE MIDKINE

Description: Recombinant MURINE MIDKINE, Animal Free, 13.3 kDa protein containing 120 amino acid residues including five intra-molecular disulfide bonds, MK chemoattracts embryonic neurons, neutrophils and macrophages, Source: E.coli, Purity: >98%, Synonyms: MK, NEGF-2100UG
Catalog Number: 10774-356
Supplier: Peprotech
Product Image-89142-056

ERP57, PAB 200 ug

Catalog Number: 89142-056
Supplier: Enzo Life Sciences
Product Image-89142-054

ERP57, PAB 50 ug

Catalog Number: 89142-054
Supplier: Enzo Life Sciences
Image Unavailable-77436-708

ANTIBODY TXNDC4 POLYCLONAL 100UL

Catalog Number: 77436-708
Supplier: Bioss
Image Unavailable-10778-838

Recombinant Murine EGF

Description: Recombinant Murine EGF, 6.0 kDa globular protein contain 53 AA residues, including 3 intramolecular disulfide bonds, potent growth factor, Animal-Free Cytokines, Source: E.coli, Cross Reactivity: Human, Mouse, >98%, Synonyms: Epidermal Growth Factor, Urogastrone, URG, 500UG
Catalog Number: 10778-838
Supplier: Peprotech
Image Unavailable-10778-840

Recombinant Murine EGF

Description: Recombinant Murine EGF, 6.0 kDa globular protein containing 53 AA residues, including 3 intramolecular disulfide bonds, potent growth factor, Animal-Free Cytokines, Source: E.coli, Cross Reactivity: Human, Mouse, >98%, Synonyms: Epidermal Growth Factor, Urogastrone, URG, 1MG
Catalog Number: 10778-840
Supplier: Peprotech
Image Unavailable-10778-836

Recombinant Murine EGF

Description: Recombinant Murine EGF, 6.0 kDa globular protein contain 53 AA residues, including 3 intramolecular disulfide bonds, potent growth factor, Animal-Free Cytokines, Source: E.coli, Cross Reactivity: Human, Mouse, >98%, Synonyms: Epidermal Growth Factor, Urogastrone, URG, 100UG
Catalog Number: 10778-836
Supplier: Peprotech
Image Unavailable-10772-802

Recombinant Human Relaxin-2

Description: Recombinant Human Relaxin-2, peptide hormone related to insulin, non-glycosylated, 6.0 kDa, disulfide-linked, heterodimeric protein consisting of a 24 amino acid A-chain, and a 29 amino acid B-chain, source: E.coli, Purity: >98%, Synonyms: H2 relaxin, RLN2, 25ug
Catalog Number: 10772-802
Supplier: Peprotech
Image Unavailable-10772-800

Recombinant Human Relaxin-2

Description: Recombinant Human Relaxin-2, peptide hormone related to insulin, non-glycosylated, 6.0 kDa, disulfide-linked, heterodimeric protein consisting of a 24 amino acid A-chain, and a 29 amino acid B-chain, source: E.coli, Purity: >98%, Synonyms: H2 relaxin, RLN2, 5ug
Catalog Number: 10772-800
Supplier: Peprotech
Image Unavailable-10772-804

Recombinant Human Relaxin-2

Description: Recombinant Human Relaxin-2, peptide hormone related to insulin, non-glycosylated, 6.0 kDa, disulfide-linked, heterodimeric protein consisting of a 24 amino acid A-chain, and a 29 amino acid B-chain, source: E.coli, Purity: >98%, Synonyms: H2 relaxin, RLN2, 100ug
Catalog Number: 10772-804
Supplier: Peprotech
929 - 944 of 19,079