Print…

You Searched For: 2,2\'-Dithienyl+disulfide


10,084  results were found

Refine Results Sort by
SearchResultCount:"10084"

Sort Results

List View Easy View

Rate These Search Results

Image Unavailable-103008-246

Human Amylin Acetate

Catalog Number: (103008-246)
Supplier: Anaspec Inc
Description: Pramlintide is the first in the new class of amylinomimetic compounds and is a synthetic analogue of the human hormone Amylin, a 37 amino acid peptide. Pramlintide’s peptide sequence differs from Amylin by replacing proline at postitions 25, 28, and 29. Pramlintide has a disulfide bridge between C2 and C7. For Research Use Only.
Sequence: KCNTATCATQRLANFLVHSSNNFGPILPPTNVGSNTY-NH2 (S-S Bond) acetate salt
MW: 3949.5 Da
% Peak Area by HPLC: ≥ 95%
Storage condition: -20°C
Image Unavailable-89357-940

Anti-ERP29 Rabbit Polyclonal Antibody

Catalog Number: (89357-940)
Supplier: Genetex
Description: Proper protein folding and post-translational modifications are essential for secretory protein export out of the endoplasmic reticulum. This task is accomplished by chaperone proteins such as protein disulfide isomerase (PDI), GRP94, and B iP. A recently characterized protein, designated ERp29, is closely related to these chaperone proteins and appears to be up regulated during ER stress conditions.
Image Unavailable-10073-008

Human Recombinant Activin A (from E. coli)

Catalog Number: (10073-008)
Supplier: Prosci
Description: Activin A is a TGF-β family member that exhibits a wide range of biological activities including regulation of cellular proliferation and differentiation, and promotion of neuronal survival. Elevated levels of Activin A in human colorectal tumors and in postmenopausal women have been implicated in colorectal and breast cancers, respectively. The biological activities of Activin A can be neutralized by inhibins and by the diffusible TGF-β antagonist, follistatin. Recombinant human Activin A is a 26.0 kDa disulfide-linked homodimer of two βA chains, each containing 116 amino acid residues.
Image Unavailable-75789-804

Human Recombinant TXNDC12 (from Cells)

Catalog Number: (75789-804)
Supplier: Prosci
Description: Thioredoxin Domain-Containing Protein 12 belongs to the thioredoxin superfamily. In this family, proteins possess a thioredoxin fold with a consensus active-site sequence (CxxC) and have roles in redox regulation, defense against oxidative stress, refolding of disulfide-containing proteins, and regulation of transcription factors. TXNDC12 is widely expressed in many tissues and contains one thioredoxin domain.
Product Image-89351-630

Anti-VEGF Mouse Monoclonal Antibody [clone: VG1]

Catalog Number: (89351-630)
Supplier: Genetex
Description: VEGF (Vascular Endothelial Growth Factor) is a homodimeric, disulfide-linked glycoprotein involved in angiogenesis which promotes tumor progression and metastasis. It exhibits potent mitogenic and permeability inducing properties specific for the vascular endothelium. Of the four isoforms of VEGF, the smaller two, VEGF 165 and VEGF 121, are secreted proteins and act as diffusible agents, whereas the larger two (VEGF 189 and VEGF 206) remain cell associated.
Image Unavailable-10764-898

Anti-CD69 Hamster Monoclonal Antibody (PE (Phycoerythrin)) [clone: H1.2F3]

Catalog Number: (10764-898)
Supplier: Prosci
Description: The H1.2F3 monoclonal antibody specifically reacts with human CD69, the 27-33 kDA type II transmembrane protein also known as the very early activation antigen (VEA) or the activation inducer molecule (AIM). It is expressed as a disulfide-linked dimer on B cells, T cells, NK cells, platelets, eosinophils, and neutrophils. It increases in expression upon cell activation and seems to serve a role as a signaling receptor.
Image Unavailable-10764-884

Anti-CD69 Mouse Monoclonal Antibody (PE (Phycoerythrin)) [clone: FN50]

Catalog Number: (10764-884)
Supplier: Prosci
Description: The FN50 monoclonal antibody specifically reacts with human CD69, the 27-33 kDA type II transmembrane protein also known as the very early activation antigen (VEA) or the activation inducer molecule (AIM). It is expressed as a disulfide-linked dimer on B cells, T cells, NK cells, platelets, eosinophils, and neutrophils. It increases in expression upon cell activation and seems to serve a role as a signaling receptor.
Image Unavailable-10072-734

Human Recombinant Prokineticin 2 (from E. coli)

Catalog Number: (10072-734)
Supplier: Prosci
Description: Prokineticin-2 (PK2) is a cysteine-rich secreted protein that is expressed in the testis and in lower levels of the small intestine. PK2 regulates various biological functions including gastrointestinal motility, angiogenesis and circadiam rhythms. It is closely related to EG-VEGF (Prokineticin-1) and binds to two orphan B-protein-coupled receptors termed PK-R1 and PK-R2. Recombinant human Prokineticin-2 is an 8.8 kDa protein consisting of 81 amino acid residues and ten cysteine residues that potentially form five pairs of intra-molecular disulfide bonds.
Image Unavailable-H-4928.0005BA

(d(CH₂)₅¹,Tyr(Me)²,Orn⁸)-Oxytocin Trifluoroacetate

Supplier: Bachem Americas
Description: For atosiban see H-6722.

Image Unavailable-75789-582

Human Recombinant SUMF1 (from Cells)

Catalog Number: (75789-582)
Supplier: Prosci
Description: Human Sulfatase Modifying Factor 1 (SUMF1) is a 42kDa protein. SUMF1 is a Ca2+-binging member of the sulfatase-modifying factor family. SUMF1 is a soluble ER lumenal glycoprotein, it converts inactive sulfatases into an active form by transforming a catalytic site cysteine into a formylglycine residue. In the ER, SUMF1 can exist as either a monomer, or a disulfide-linked homodimer or a heterodimer with SUMF2. Three splice isoforms are known.
Image Unavailable-10764-890

Anti-CD69 Hamster Monoclonal Antibody [clone: H1.2F3]

Catalog Number: (10764-890)
Supplier: Prosci
Description: The H1.2F3 monoclonal antibody specifically reacts with human CD69, the 27-33 kDA type II transmembrane protein also known as the very early activation antigen (VEA) or the activation inducer molecule (AIM). It is expressed as a disulfide-linked dimer on B cells, T cells, NK cells, platelets, eosinophils, and neutrophils. It increases in expression upon cell activation and seems to serve a role as a signaling receptor.
Image Unavailable-10764-886

Anti-CD69 Hamster Monoclonal Antibody [clone: H1.2F3]

Catalog Number: (10764-886)
Supplier: Prosci
Description: The H1.2F3 monoclonal antibody specifically reacts with human CD69, the 27-33 kDA type II transmembrane protein also known as the very early activation antigen (VEA) or the activation inducer molecule (AIM). It is expressed as a disulfide-linked dimer on B cells, T cells, NK cells, platelets, eosinophils, and neutrophils. It increases in expression upon cell activation and seems to serve a role as a signaling receptor.
Image Unavailable-10072-600

Human Recombinant Neuritin (from E. coli)

Catalog Number: (10072-600)
Supplier: Prosci
Description: Neuritin is a neurotrophic factor, which is expressed in response to induction of neuronal activity by NGF, BDNF, NT3, and other neural stimulators. It is expressed primarily in postmitotic-differentiating neurons of the developing nervous system and in neuronal structures related to synaptic plasticity in the adult nervous system. Neuritin acts as a molecular mediator of neurite outgrowth, neuronal survival, and synaptic maturation. Recombinant human Neuritin is a covalently disulfide-linked homodimer, consisting of two 9.7 kDa polypeptide monomers, each containing 88 amino acid residues.
Product Image-10782-408

Anti-native DBH Rabbit Polyclonal Antibody

Catalog Number: (10782-408)
Supplier: Biosensis
Description: DBH is an oxireductase belonging to the copper type II ascorbate-dependent monooxygenase family. DBH exists as a homotetramer composed of two non-covalently bound disulfide-linked dimers. It is present in the synaptic vesicles of postganglionic sympathetic neurons and converts dopamine to norepinephrine. It binds 2 copper ions and 1 PQQ per subunit . Depending on the presence of a signal peptide, DBH can exist in both soluble and membrane-bound forms.
Image Unavailable-75912-080

Anti-ICAM3 Mouse Monoclonal Antibody [clone: ICAM3/1019]

Catalog Number: (75912-080)
Supplier: Biotium
Description: This antibody recognizes an N-glycosylated glycoprotein of 120 kDa with intra-chain disulfide bonds, identified as CD50 or ICAM-3. CD50 is the major ligand for LFA-1 (CD11a/CD18) and may have signaling role to increase adhesion. It is expressed on thymocytes and T lymphocytes and is resistant to treatment with phosphatidylinositol (PI) phospholipase C. This MAb is excellent for staining of formalin/paraffin tissues.
Image Unavailable-10764-902

Anti-CD69 Hamster Monoclonal Antibody (PE (Phycoerythrin)) [clone: H1.2F3]

Catalog Number: (10764-902)
Supplier: Prosci
Description: The H1.2F3 monoclonal antibody specifically reacts with human CD69, the 27-33 kDA type II transmembrane protein also known as the very early activation antigen (VEA) or the activation inducer molecule (AIM). It is expressed as a disulfide-linked dimer on B cells, T cells, NK cells, platelets, eosinophils, and neutrophils. It increases in expression upon cell activation and seems to serve a role as a signaling receptor.
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
You must log in to order restricted items. We request that you provide the required business documentation to purchase this product for the first time.

To order chemicals, medical devices, or other restricted products please provide identification that includes your business name and shipping address via email CMD_NA@vwr.com or fax 484.881.5997 referencing your VWR account number . Acceptable forms of identification are:

  • issued document with your organization's Federal Tax ID Number
  • Government issued document with your organization's Resale Tax ID Number
  • Any other Government ID that includes the business name and address


VWR will not lift restrictions for residential shipping addresses.

-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is currently unavailable but limited stock may be available in our extended warehouse network. Please call 1-800-932-5000 and a VWR Customer Service Representative will help you.
609 - 624 of 10,084
no targeter for Bottom