You Searched For: 2,2\'-Dithienyl+disulfide


19,797  results were found

Sort Results

List View Easy View
SearchResultCount:"19797"
Description: ERp29 Polyclonal Antibody, Host: Rabbit , FITC Conjugated, Emmission: 494nm/518nm, Isotype: IgG, Species: Human, Mouse, Rat, Synonymns: Chromosome 12 open reading frame 8, Application: IF(IHC-P), 100ul
Catalog Number: 10408-940
Supplier: Bioss


Description: Recombinant Human PDGF-AA, 28.5 kDa disulfide-linked homodimer of two A chains (250 total amino acids). Animal Free, Source: E.coli, Cross Reactivity: Dog, Monkey, Mouse, Purity: Greater than 98%, Synonym: Platelet-Derived Growth Factor-AA, Pack Size: 100UG
Catalog Number: 10771-908
Supplier: Peprotech


Description: Recombinant Human PDGF-AA, 28.5 kDa disulfide-linked homodimer of two A chains (250 total amino acids). Animal Free, Source: E.coli, Cross Reactivity: Dog, Monkey, Mouse, Purity: Greater than 98%, Synonym: Platelet-Derived Growth Factor-AA, Pack Size: 10UG
Catalog Number: 10771-904
Supplier: Peprotech


Description: Recombinant Human PDGF-AA, 28.5 kDa disulfide-linked homodimer of two A chains (250 total amino acids). Animal Free, Source: E.coli, Cross Reactivity: Dog, Monkey, Mouse, Purity: Greater than 98%, Synonym: Platelet-Derived Growth Factor-AA, Pack Size: 250UG
Catalog Number: 10771-910
Supplier: Peprotech


Description: Recombinant Human PDGF-AA, 28.5 kDa disulfide-linked homodimer of two A chains (250 total amino acids). Animal Free, Source: E.coli, Cross Reactivity: Dog, Monkey, Mouse, Purity: Greater than 98%, Synonym: Platelet-Derived Growth Factor-AA, Pack Size: 50UG
Catalog Number: 10771-906
Supplier: Peprotech


Description: Recombinant Human PDGF-AA, 28.5 kDa disulfide-linked homodimer of two A chains (250 total amino acids). Animal Free, Source: E.coli, Cross Reactivity: Dog, Monkey, Mouse, Purity: Greater than 98%, Synonym: Platelet-Derived Growth Factor-AA, Pack Size: 500UG
Catalog Number: 10771-912
Supplier: Peprotech


Description: Apamin, Purity: By HPLC >/= 95%, MW: 2027.4, Sequence: (One-Letter Code): CNCKAPETALCARRCQQH-NH2 (Disulfide bridge: 1-11, 3-15) An 18-amino acid peptide from bee venom, a selective blocker of calcium activated potassium channels, Physical State: White Powder, Size: 0.5 mg
Catalog Number: 103005-972
Supplier: Anaspec Inc


Catalog Number: CAAAA14715-06
Supplier: Thermo Scientific Chemicals

Description: RUBISCO Polyclonal Antibody, Host: Rabbit , Cy5 Conjugated, Emmission: 625,650nm/670nm, Isotype: IgG, Species: Plant (Arabidopsis thaliana), Synonymns: rbcL; RBL_SPIOL, Application: IF(IHC-P), 100ul
Catalog Number: 10459-176
Supplier: Bioss


Catalog Number: CAAAA14715-22
Supplier: Thermo Scientific Chemicals

Catalog Number: CAAAA14715-14
Supplier: Thermo Scientific Chemicals

Description: Big Endothelin-1 (1-38), human, Sequence: CSCSSLMDKECVYFCHLDIIWVNTPEHVVPYGLGSPRS (Disulfide bridge: 1-15 and 3-11), Purity: By HPLC >/= 95%, Big Endothelin-1 (1-38) is precursor of endothelin 1, Molecular Weight: 4283, Storage: -20 C, Size: 0.5 mg
Catalog Number: 103007-562
Supplier: Anaspec Inc


Catalog Number: 76098-746
Supplier: Bioss


Description: Recombinant MURINE RELM-BETA, Animal Free, 18.0kda protein, consist of two identical 83AA polypeptide chains linked by a single disulfide bond, Source: E.coli, Cross reactivity: Mouse, Pig Intestinal Worm, Purity: >98%, Synonym: Cysteine-rich secreted protein FIZZ2500UG
Catalog Number: 10774-696
Supplier: Peprotech


Description: Recombinant MURINE RELM-BETA, Animal Free, 18.0kda protein, consist of two identical 83AA polypeptide chains linked by a single disulfide bond, Source: E.coli, Cross reactivity: Mouse, Pig Intestinal Worm, Purity: >98%, Synonym: Cysteine-rich secreted protein FIZZ2100UG
Catalog Number: 10774-692
Supplier: Peprotech


Description: Recombinant MURINE RELM-BETA, Animal Free, 18.0kda protein, consist of two identical 83AA polypeptide chains linked by a single disulfide bond, Source: E.coli, Cross reactivity: Mouse, Pig Intestinal Worm, Purity: >98%, Synonym: Cysteine-rich secreted protein FIZZ2250UG
Catalog Number: 10774-694
Supplier: Peprotech


513 - 528 of 19,797