You Searched For: beta-Alanine+benzyl+ester+p-toluenesulfonate


15,172  results were found

SearchResultCount:"15172"

Sort Results

List View Easy View

Rate These Search Results

Catalog Number: (10206-222)
Supplier: Boster Biological Technology
Description: Polyclonal antibody for CD104/ITGB4 detection. Host: Rabbit.Size: 100μg/vial. Tested applications: IHC-P. Reactive species: Human. CD104/ITGB4 information: Molecular Weight: 202167 MW; Subcellular Localization: Cell membrane; Single-pass type I membrane protein. Cell membrane; Lipid-anchor. Cell junction, hemidesmosome. Colocalizes with DST at the leading edge of migrating keratinocytes; Tissue Specificity: Integrin alpha-6/beta-4 is predominantly expressed by epithelia. Isoform beta-4D is also expressed in colon and placenta. Isoform beta-4E is also expressed in epidermis, lung, duodenum, heart, spleen and stomach.


Catalog Number: (10414-958)
Supplier: Bioss
Description: IKK beta (I-Kappa-B kinase-beta) is a member of the IKK complex which is composed of IKK alpha, IKK beta, IKK gamma and IKAP. Phosphorylation of I-Kappa-B on a serine residue by the IKK complex frees NF-kB from I-Kappa-B and marks it for degradation via ubiquination. IKK beta has been shown to activate NF-kB and phosphorylate IKB alpha and beta. Phosphorylation of 2 sites at the activation loop of IKK beta is essential for activation of IKK by TNF and IL1. Once activated, IKK beta autophosphorylates which in turn decreases IKK activity and prevents prolonged activation of the inflammatory response. Additionally, IKK beta activity can also be regulated by MEKK1.


Catalog Number: (89419-186)
Supplier: Prosci
Description: Beta-actin peptide is used for blocking the activity of beta-actin antibody.


Catalog Number: (10209-944)
Supplier: Boster Biological Technology
Description: Rabbit IgG polyclonal antibody for Inhibitor of nuclear factor kappa-B kinase subunit beta(IKBKB) detection. Tested with WB in Human;Mouse;Rat.


Catalog Number: (75788-818)
Supplier: Prosci
Description: Human beta -Nerve Growth Factor ( beta -NGF) was initially isolated in the mouse submandibular gland. It is composed of three non-covalently linked subunits alpha, beta , and gamma ; it exhibits all the biological activities ascribed to NGF. It is structurally related to BDNF, NT-3 and NT-4 and belongs to the cysteine-knot family of growth factors that assume stable dimeric structures. beta -NGF is a neurotrophic factor that signals through its receptor beta -NGF, and plays a crucial role in the development and preservation of the sensory and sympathetic nervous systems. beta -NGF also acts as a growth and differentiation factor for B lymphocytes and enhances B-cell survival. These results suggest that beta -NGF is a pleiotropic cytokine, which in addition to its neurotropic activities may have an important role in the regulation of the immune system. Human beta -NGF shares 90% sequence similarity with mouse protein and shows cross-species reactivity.


Supplier: Cytiva
Description: Mixed cellulose ester, WME range, circles, gridded. Whatman mixed cellulose ester membranes are composed of cellulose acetate and cellulose nitrate. These membranes are characterized by a smoother and more uniform surface than pure nitrocellulose filters.
Catalog Number: (89419-184)
Supplier: Prosci
Description: Beta-actin peptide is used for blocking the activity of beta-actin antibody.


Catalog Number: (103007-214)
Supplier: Anaspec Inc
Description: This is amino acids 1 to 40 fragment of the beta-amyloid peptide with lysine substituted for glutamic acid at position 22, found in Italian families. The Italian mutation of beta-amyloid 1-40 (E22K) aggregates more rapidly and with more potent neurotoxicity than wild-type beta-amyloid 1-40. The formation of a salt bridge between Lys-22 and Asp-23 in the minor conformer might be a reason why E22K-beta-amyloid 40 is more pathogenic than wild-type beta-amyloid 40.
Sequence: DAEFRHDSGYEVHHQKLVFFAKDVGSNKGAIIGLMVGGVV
Molecular Weight: 4328.9 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C


Catalog Number: (10206-036)
Supplier: Boster Biological Technology
Description: Mouse IgG monoclonal antibody for beta-HCG, chorionic gonadotropin, beta polypeptide (CGB) detection. Tested with IHC-P in Human. No cross reactivity with other proteins.


Supplier: Bachem Americas
Description: Sequence: 2-(N-Phenyl-N-benzyl-aminomethyl)-imidazoline · 0.5 H₂SO₄

Catalog Number: (10414-982)
Supplier: Bioss
Description: IKK beta (I-Kappa-B kinase-beta) is a member of the IKK complex which is composed of IKK alpha, IKK beta, IKK gamma and IKAP. Phosphorylation of I-Kappa-B on a serine residue by the IKK complex frees NF-kB from I-Kappa-B and marks it for degradation via ubiquination. IKK beta has been shown to activate NF-kB and phosphorylate IKB alpha and beta. Phosphorylation of 2 sites at the activation loop of IKK beta is essential for activation of IKK by TNF and IL1. Once activated, IKK beta autophosphorylates which in turn decreases IKK activity and prevents prolonged activation of the inflammatory response. Additionally, IKK beta activity can also be regulated by MEKK1.


Catalog Number: (103007-598)
Supplier: Anaspec Inc
Description: This is amino acids 11 to 42 fragment of beta-amyloid. This peptide was detected in Alzheimer disease brains within several principal beta-amyloid variants.
Sequence: EVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA
Molecular Weight: 3335.9 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C


Catalog Number: (10209-454)
Supplier: Boster Biological Technology
Description: Polyclonal antibody for IL 1 BETA/IL1B detection. Host: Rabbit.Size: 100μg/vial. Tested applications: ELISA. Reactive species: Rat. IL 1 BETA/IL1B information: Molecular Weight: 30644 MW; Subcellular Localization: Secreted. The lack of a specific hydrophobic segment in the precursor sequence suggests that IL-1 is released by damaged cells or is secreted by a mechanism differing from that used for other secretory proteins.


Supplier: Bon Opus Biosciences
Description: Bon Opus Biosciences offers quality recombinant proteins products covering a broad collection of cytokines, enzymes, diagnostic and detection reagents, and other protein-related products

Catalog Number: (10415-808)
Supplier: Bioss
Description: IKK beta (I-Kappa-B kinase-beta) is a member of the IKK complex which is composed of IKK alpha, IKK beta, IKK gamma and IKAP. Phosphorylation of I-Kappa-B on a serine residue by the IKK complex frees NF-kB from I-Kappa-B and marks it for degradation via ubiquination. IKK beta has been shown to activate NF-kB and phosphorylate IKB alpha and beta. Phosphorylation of 2 sites at the activation loop of IKK beta is essential for activation of IKK by TNF and IL1. Once activated, IKK beta autophosphorylates which in turn decreases IKK activity and prevents prolonged activation of the inflammatory response. Additionally, IKK beta activity can also be regulated by MEKK1.


Catalog Number: (H-2236.1000BA)
Supplier: Bachem Americas
Description: Please see also 5-(Pentafluorobenzoylamino)fluorescein (M-2375), a sensitive fluorogenic substrate for the determination of glutathione S-transferase (GST) activity and glutathione (GSH) concentration, and the carba-analog of GSH, ophthalmic acid, H-3145.


Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
You must log in to order restricted items. We request that you provide the required business documentation to purchase this product for the first time.

To order chemicals, medical devices, or other restricted products please provide identification that includes your business name and shipping address via email CMD_NA@vwr.com or fax 484.881.5997 referencing your VWR account number . Acceptable forms of identification are:

  • issued document with your organization's Federal Tax ID Number
  • Government issued document with your organization's Resale Tax ID Number
  • Any other Government ID that includes the business name and address


VWR will not lift restrictions for residential shipping addresses.

-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is currently unavailable but limited stock may be available in our extended warehouse network. Please call 1-800-932-5000 and a VWR Customer Service Representative will help you.
1,473 - 1,488 of 15,172
no targeter for Bottom