Human Recombinant GPX4 (from E. coli)

Supplier: Creative Biomart

GPX4-1894H-100UG GPX4-1894H-50UG
77539-638EA 484.97 CAD
77539-638 77539-640
Human Recombinant GPX4 (from E. coli)
Proteins and Peptides

Order Now

SPECIFICATIONS

Protein/peptide name GPX4
Protein synonyms glutathione peroxidase 4
Environmentally Preferable
Protein/peptide type Recombinant
Species Human
Source E. coli
Conjugation Unconjugated
Sequence MHHHHHHENLYFQSMCASRDDWRCARSMHEFSAKDIDGHMVNLDKYRGFVCIVTNVASQCGKTEVNYTQLVDLHARYAECGLRILAFPCNQFGKQEPGSNEEIKEFAAGYNVKFDMFSKICVNGDDAHPLWKWMKIQPKGKGILGNAIKWNFTKFLIDKNGCVVKRYGPMEEPLVIEKDLPHYF
Protease-free No
Animal-free No
Nuclease-free No
Carrier-free No
Endotoxin-free No
Endotoxin level Low
Endotoxin content <1 EU/µg
UniProtKB P36969
Purity >90%, by SDS-PAGE
Grade Ultrapure grade
Concentration 0.125 mg/ml
Molecular weight ~21.3 kDa, reducing conditions
Storage conditions 4 °C
Shipping temperature 20

Learn more

About VWR

Avantor is a vertically integrated, global supplier of discovery-to-delivery solutions for...

Learn more About VWR