You Searched For: Benzyl+chloroformate


1  results were found

Sort Results

List View Easy View
SearchResultCount:"1"
Description: Adrenomedullin (1-50), rat, Purity: HPLC >/- 95%, Molecular Weight: 5729.5, Sequence: YRQSMNQGSRSTGCRFGTCTMQKLAHQIYQFTDKDKDGMAPRNKISPQGY-NH2, Rat adrenomedullin, rADM, (1-50) and its C-terminal rADM (11-50) induce a dose-dependent, Storage: -20 deg C, Size: 0.5 mg
Catalog Number: 103003-158
Supplier: Anaspec Inc


Description: Beta-Amyloid (1-39), Purity: HPLC >/= 95%, Molecular Weight: 4230.7, Sequence: DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGV, Appearance: Lyophilized white powder, identified as the major components of the cerebral amyloid deposits in Alzheimer’s disease, Size: 1 mg
Catalog Number: 102996-522
Supplier: Anaspec Inc


Description: QXL*570 acid, SE, Molecular Weight: 597.77, Solvent System DMSO or DMF, dyes are the optimized quenchers for quenchers for rhodamines and Cy3 fluorophores, Their absorption spectra perfectly overlap with the fluorescence spectra of TAMRA, ROX and Cy3, size: 10 mg
Catalog Number: 103010-228
Supplier: Anaspec Inc


Description: VIP, human, porcine, rat, Purity: HPLC >/= to 95%, Molecular Weight: 3325.9, Sequence: HSDAVFTDNYTRLRKQMAVKKYLNSILN-NH2, Appearance: Lyophilized white powder, is a neurotransmitter and a neuromodulator, broadly distributed in the peripheral and central nervous systems, Size: 1 mg
Catalog Number: 102996-316
Supplier: Anaspec Inc


Description: BFGF (119 - 126), Basic Fibroblast Growth Factor, human, bovine, (KRTGQYKL), Purity: HPLC >/= 95%, Sequence (Three-Letter Code): H - Lys - Arg - Thr - Gly - Gln - Tyr - Lys - Leu - OH, MW: 993.2, Physical State: Solid, Storage: -20 degree C, Size: 1 mg
Catalog Number: 103006-334
Supplier: Anaspec Inc


Description: Nuclear Factor (Erythroid-derived 2)like 2 (74-87); Nrf2 (74-87); NFE2L2 (74-87), Purity: HPLC >/= 95%, MW: 1631.8, Sequence: [LQLDEETGEFLPIQ] This peptide is derived from the Neh2 domain of nuclear factor, Store: -20 deg C, Size: 1mg
Catalog Number: 103009-894
Supplier: Anaspec Inc


Description: Atrial Natriuretic Peptide (1-28), rat, Purity: HPLC >/= to 95%, Molecular Weight: 3062.5, Sequence: SLRRSSCFGGRIDRIGAQSGLGCNSFRY, Appearance: Lyophilized white powder, Storage: -20 deg C, Size: 1 mg
Catalog Number: 102996-080
Supplier: Anaspec Inc


Description: Beta-Amyloid (42-1), Human, Sequence: AIVVGGVMLGIIAGKNSGVDEAFFVLKQHHVEYGSDHRFEAD, Purity: Peak Area By HPLC greater than or equal to 95%, Molecular Weight: 4514.1, Appearance: Lyophilized white powder, Storage: -20 degree C, Size: 0.5 mg
Catalog Number: 103000-620
Supplier: Anaspec Inc


Description: Melittin, honey bee, Sequence: GIGAVLKVLTTGLPALISWIKRKRQQ - NH2, Purity: By HPLC >/= 95%, a 26-residue bee venom peptide, is known to induce murine antibodies, an anti-inflammatory agent, it inhibits the lyme disease spirochete, Molecular Weight: 2846.5, Size: 1 mg
Catalog Number: 103007-312
Supplier: Anaspec Inc


Description: [Lys(Ac)9] - Histone H3 (1 - 21)-NH2 H3K9(Ac), biotin-labeled, Sequence: ARTKQTAR-K(Ac)-STGGKAPRKQLA-GGK(Biotin)-NH2, Purity: By HPLC >/= 95%, biotin labeled H3K9(Ac) Histone, Molecular Weight: 2764.3, Storage: -20 deg C, Size: 1 mg
Catalog Number: 103007-960
Supplier: Anaspec Inc


Description: [Ser140] - PLP (139 - 151), serine substituted PLP (139-151) causes severe, acute experimental allergic encephalomyelitis in SJL mice, Purity: Peak Area By HPLC >/= 95%, Molecular Weight 1521.8, Sequence (1-Letter Code): HSLGKWLGHPDKF, Storage: -20 deg C, Size: 1mg
Catalog Number: 103004-226
Supplier: Anaspec Inc


Description: HIV-1 Tat (48-60), Sequence: GRKKRRQRRRPPQ, Purity: By HPLC >/= 95%, This is one of the cell-penetrating peptides (CPPs) derived from the human immunodeficient virus (HIV)-1 Tat protein residue 48-60, Molecular Weight: 1719, Storage: -20 deg C, Size: 1 mg
Catalog Number: 103007-776
Supplier: Anaspec Inc


Description: Endothelin 1, human, Purity: Greater than or equal to 95% (HPLC), Molecular weight: 2848.4, Sequence: Fluor 488-CSCSSLMDKECVYFCHLDIIW (Disulfide Bridge: 1-15 & 3-11), Label: HiLyte* Fluor 488, vasoconstrictor peptide from endothelial cells, Storage: -20 degree C, Size: 0.25mg
Catalog Number: 103008-468
Supplier: Anaspec Inc


Description: Cyclo ( - RGDfK), high affinity to AvB3 receptors on neovascular blood vessel sections of major human cancers, Purity: HPLC >/= 95%, Sequence (3-Letter Code): Cyclo( - Arg - Gly - Asp - D-Phe-Lys), MW: 603.7, Appearance: Lyophilized white powder, Storage: -20deg C, Size: 1mg
Catalog Number: 103006-354
Supplier: Anaspec Inc


Description: HiLyte* Fluor 488 acid, Protein conjugate is prepared, for fluorescein derivatives as FITC, MW: 601.53, Spectral Properties: Abs/Em = 501/527 nm, Solvent System: DMF or DMSO, Physical State: Solid, Storage: -20 deg C, Store away from oxidizing agent, Size: 10 mg
Catalog Number: 103010-872
Supplier: Anaspec Inc


Description: MMP Colorimetric Substrate I, Purity: HPLC >/= to 95%, Molecular Weight: 655.9, Sequence: Ac-Pro-Leu-Gly-SCH[CH2CH(CH3)2]-CO-Leu-Gly-OC2H5, Appearance: powder, this peptide is used for the continuous spectrophotometric assay of MMP-2 and MMP-9, Size: 1 mg
Catalog Number: 102996-774
Supplier: Anaspec Inc