You Searched For: Benzyl+chloroformate

Description: Adrenomedullin (1-50), rat, Purity: HPLC >/- 95%, Molecular Weight: 5729.5, Sequence: YRQSMNQGSRSTGCRFGTCTMQKLAHQIYQFTDKDKDGMAPRNKISPQGY-NH2, Rat adrenomedullin, rADM, (1-50) and its C-terminal rADM (11-50) induce a dose-dependent, Storage: -20 deg C, Size: 0.5 mg

Catalog Number: 103003-158

Supplier: Anaspec Inc

Sale

Description: Beta-Amyloid (1-39), Purity: HPLC >/= 95%, Molecular Weight: 4230.7, Sequence: DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGV, Appearance: Lyophilized white powder, identified as the major components of the cerebral amyloid deposits in Alzheimer’s disease, Size: 1 mg

Catalog Number: 102996-522

Supplier: Anaspec Inc

Sale

Description: QXL*570 acid, SE, Molecular Weight: 597.77, Solvent System DMSO or DMF, dyes are the optimized quenchers for quenchers for rhodamines and Cy3 fluorophores, Their absorption spectra perfectly overlap with the fluorescence spectra of TAMRA, ROX and Cy3, size: 10 mg

Catalog Number: 103010-228

Supplier: Anaspec Inc

Sale

Description: VIP, human, porcine, rat, Purity: HPLC >/= to 95%, Molecular Weight: 3325.9, Sequence: HSDAVFTDNYTRLRKQMAVKKYLNSILN-NH2, Appearance: Lyophilized white powder, is a neurotransmitter and a neuromodulator, broadly distributed in the peripheral and central nervous systems, Size: 1 mg

Catalog Number: 102996-316

Supplier: Anaspec Inc

Sale

Description: BFGF (119 - 126), Basic Fibroblast Growth Factor, human, bovine, (KRTGQYKL), Purity: HPLC >/= 95%, Sequence (Three-Letter Code): H - Lys - Arg - Thr - Gly - Gln - Tyr - Lys - Leu - OH, MW: 993.2, Physical State: Solid, Storage: -20 degree C, Size: 1 mg

Catalog Number: 103006-334

Supplier: Anaspec Inc

Sale

Description: Nuclear Factor (Erythroid-derived 2)like 2 (74-87); Nrf2 (74-87); NFE2L2 (74-87), Purity: HPLC >/= 95%, MW: 1631.8, Sequence: [LQLDEETGEFLPIQ] This peptide is derived from the Neh2 domain of nuclear factor, Store: -20 deg C, Size: 1mg

Catalog Number: 103009-894

Supplier: Anaspec Inc

Sale

Description: Atrial Natriuretic Peptide (1-28), rat, Purity: HPLC >/= to 95%, Molecular Weight: 3062.5, Sequence: SLRRSSCFGGRIDRIGAQSGLGCNSFRY, Appearance: Lyophilized white powder, Storage: -20 deg C, Size: 1 mg

Catalog Number: 102996-080

Supplier: Anaspec Inc

Sale

Description: Beta-Amyloid (42-1), Human, Sequence: AIVVGGVMLGIIAGKNSGVDEAFFVLKQHHVEYGSDHRFEAD, Purity: Peak Area By HPLC greater than or equal to 95%, Molecular Weight: 4514.1, Appearance: Lyophilized white powder, Storage: -20 degree C, Size: 0.5 mg

Catalog Number: 103000-620

Supplier: Anaspec Inc

Sale

Description: Melittin, honey bee, Sequence: GIGAVLKVLTTGLPALISWIKRKRQQ - NH2, Purity: By HPLC >/= 95%, a 26-residue bee venom peptide, is known to induce murine antibodies, an anti-inflammatory agent, it inhibits the lyme disease spirochete, Molecular Weight: 2846.5, Size: 1 mg

Catalog Number: 103007-312

Supplier: Anaspec Inc

Sale

Description: [Lys(Ac)9] - Histone H3 (1 - 21)-NH2 H3K9(Ac), biotin-labeled, Sequence: ARTKQTAR-K(Ac)-STGGKAPRKQLA-GGK(Biotin)-NH2, Purity: By HPLC >/= 95%, biotin labeled H3K9(Ac) Histone, Molecular Weight: 2764.3, Storage: -20 deg C, Size: 1 mg

Catalog Number: 103007-960

Supplier: Anaspec Inc

Sale

Description: [Ser140] - PLP (139 - 151), serine substituted PLP (139-151) causes severe, acute experimental allergic encephalomyelitis in SJL mice, Purity: Peak Area By HPLC >/= 95%, Molecular Weight 1521.8, Sequence (1-Letter Code): HSLGKWLGHPDKF, Storage: -20 deg C, Size: 1mg

Catalog Number: 103004-226

Supplier: Anaspec Inc

Sale

Description: HIV-1 Tat (48-60), Sequence: GRKKRRQRRRPPQ, Purity: By HPLC >/= 95%, This is one of the cell-penetrating peptides (CPPs) derived from the human immunodeficient virus (HIV)-1 Tat protein residue 48-60, Molecular Weight: 1719, Storage: -20 deg C, Size: 1 mg

Catalog Number: 103007-776

Supplier: Anaspec Inc

Sale

Description: Endothelin 1, human, Purity: Greater than or equal to 95% (HPLC), Molecular weight: 2848.4, Sequence: Fluor 488-CSCSSLMDKECVYFCHLDIIW (Disulfide Bridge: 1-15 & 3-11), Label: HiLyte* Fluor 488, vasoconstrictor peptide from endothelial cells, Storage: -20 degree C, Size: 0.25mg

Catalog Number: 103008-468

Supplier: Anaspec Inc

Sale

Description: Cyclo ( - RGDfK), high affinity to AvB3 receptors on neovascular blood vessel sections of major human cancers, Purity: HPLC >/= 95%, Sequence (3-Letter Code): Cyclo( - Arg - Gly - Asp - D-Phe-Lys), MW: 603.7, Appearance: Lyophilized white powder, Storage: -20deg C, Size: 1mg

Catalog Number: 103006-354

Supplier: Anaspec Inc

Sale

Description: HiLyte* Fluor 488 acid, Protein conjugate is prepared, for fluorescein derivatives as FITC, MW: 601.53, Spectral Properties: Abs/Em = 501/527 nm, Solvent System: DMF or DMSO, Physical State: Solid, Storage: -20 deg C, Store away from oxidizing agent, Size: 10 mg

Catalog Number: 103010-872

Supplier: Anaspec Inc

Sale

Description: MMP Colorimetric Substrate I, Purity: HPLC >/= to 95%, Molecular Weight: 655.9, Sequence: Ac-Pro-Leu-Gly-SCH[CH2CH(CH3)2]-CO-Leu-Gly-OC2H5, Appearance: powder, this peptide is used for the continuous spectrophotometric assay of MMP-2 and MMP-9, Size: 1 mg

Catalog Number: 102996-774

Supplier: Anaspec Inc

Sale