You Searched For: Pifithrin-\u03B1+(cyclic)+hydrobromide


1  results were found

SearchResultCount:"1"

Sort Results

List View Easy View

Rate These Search Results

Catalog Number: (CA80057-832)
Supplier: MilliporeSigma
Description: Protects cells against damaging effects of radiation and oxygen radicals. Increases rate of mineralization in osteoblasts. A cofactor involved in hydroxylation of proline and lysine. Reduces Na+-Ca2+ exchange in cultured astrocytes. Modulates cyclic nucleotide levels in B and T cells. Inhibits apoptosis in cultured rat ovarian follicles.

Catalog Number: (10390-082)
Supplier: Bioss
Description: This gene encodes a membrane-bound adenylate cyclase that catalyses the formation of cyclic AMP from ATP and is inhibitable by calcium. The product of this gene is a member of the adenylyl cyclase class-4/guanylyl cyclase enzyme family that is characterized by the presence of twelve membrane-spanning domains in its sequences. [provided by RefSeq, Jul 2008].


Catalog Number: (10390-086)
Supplier: Bioss
Description: This gene encodes a membrane-bound adenylate cyclase that catalyses the formation of cyclic AMP from ATP and is inhibitable by calcium. The product of this gene is a member of the adenylyl cyclase class-4/guanylyl cyclase enzyme family that is characterized by the presence of twelve membrane-spanning domains in its sequences. [provided by RefSeq, Jul 2008].


Catalog Number: (10390-090)
Supplier: Bioss
Description: This gene encodes a membrane-bound adenylate cyclase that catalyses the formation of cyclic AMP from ATP and is inhibitable by calcium. The product of this gene is a member of the adenylyl cyclase class-4/guanylyl cyclase enzyme family that is characterized by the presence of twelve membrane-spanning domains in its sequences. [provided by RefSeq, Jul 2008].


Catalog Number: (10390-088)
Supplier: Bioss
Description: This gene encodes a membrane-bound adenylate cyclase that catalyses the formation of cyclic AMP from ATP and is inhibitable by calcium. The product of this gene is a member of the adenylyl cyclase class-4/guanylyl cyclase enzyme family that is characterized by the presence of twelve membrane-spanning domains in its sequences. [provided by RefSeq, Jul 2008].


Catalog Number: (10390-080)
Supplier: Bioss
Description: This gene encodes a membrane-bound adenylate cyclase that catalyses the formation of cyclic AMP from ATP and is inhibitable by calcium. The product of this gene is a member of the adenylyl cyclase class-4/guanylyl cyclase enzyme family that is characterized by the presence of twelve membrane-spanning domains in its sequences. [provided by RefSeq, Jul 2008].


Catalog Number: (89367-338)
Supplier: Genetex
Description: Cyclic nucleotides are important intracellular second messengers which play an important role in a variety of signal transduction process. The cyclic nucleotides are hydrolyzed and compartmentalized by a family of enzymes called phosphodiesterases. One of the many phosphodiesterases that compartmentalize and hydrolyze cAMP and cGMP into AMP and GMP is PDE2. Two genes, PDE2A and PDE2B, have been identified and cloned and they both have an apparent molecular weight of 100 kDA. PDE2A has specificity for cAMP and its activity is modulated by the presence of cGMP. In contrast, PDE2B does not hydrolyze cGMP nor its activity is altered by the presence of cGMP. Western blot analyses of PDE2A reveals that it is present in a variety of tissues including neocortex, cerebellum, heart, kidney lungs, pulmonary artery and skeletal muscle.


Catalog Number: (89367-364)
Supplier: Genetex
Description: PDE9A catalyzes the hydrolysis of cAMP and cGMP to their corresponding monophosphates. The protein plays a role in signal transduction by regulating the intracellular concentration of these cyclic nucleotides. Multiple transcript variants encoding several different isoforms have been found for this gene. PDE9A is widely expressed in various tissues, including spleen, small intestine and brian.


Supplier: Anaspec Inc
Description: Human calcitonin reduces blood calcium, opposing the effects of parathyroid hormone (PTH). It stimulates cyclic nucleotide accumulation in human kidney cortex and medulla. Calcitonin maybe involved in osteoporosis and in Paget's disease.
Sequence: CGNLSTCMLGTYTQDFNKFHTFPQTAIGVGAP-NH2 (Disulfide bridge: 1-7)
MW: 3417.9 Da
% Peak area by HPLC: 95
Storage condition: -20° C

Catalog Number: (89157-044)
Supplier: Enzo Life Sciences
Description: Cell-permeable, phosphodiesterase-resistant cGMP antagonist. Reversed NO stimulation of random migration in rabbit neutrophils. Used at 30µM to cometively inhibit 8-Br-cGMP relaxation of rabbit aortas. The product is not sterile. Resistant to nucleotide-dependent phosphodiesterases; no metabolic side effects. Significantly more lipophilic and membrane permeant as compared to cyclic GMP or Rp-cGMPS.


Catalog Number: (89157-014)
Supplier: Enzo Life Sciences
Description: Rp-cAMPS is a potent and specific competitive inhibitor of the activation of cAMP-dependent protein kinases by cAMP (IC50=4.9 µM) . Its cell permeability and complete resistance to cyclic nucleotide phosphodiesterases make it a unique tool for studying cAMP-dependent signaling. Significantly more lipophilc as compared to cAMP and thus membrane permeable in many biological systems. This product is not sterile.


Supplier: Bachem Americas
Description: Antimicrobial peptides are produced by plants and most organisms throughout the animal kingdom including humans. Antimicrobial peptides protect against a broad range of infectious agents, as bacteria, fungi, and viruses. The amphibian skin is an especially rich source of antimicrobial peptides. See also the product families: Hepcidins LL-37 and Fragments Tuftsin and Analogs (subfamily).

Catalog Number: (10106-444)
Supplier: Prosci
Description: The ANXA3 gene encodes a member of the annexin family. Members of this calcium-dependent phospholipid-binding protein family play a role in the regulation of cellular growth and in signal transduction pathways. This protein functions in the inhibition of phopholipase A2 and cleavage of inositol 1,2-cyclic phosphate to form inositol 1-phosphate. This protein may also play a role in anti-coagulation.


Catalog Number: (89367-424)
Supplier: Genetex
Description: MRP4 transports cyclic nucleotides and anti-retroviral compounds and may be an organic anion pump relevant to cellular detoxification. It is widely expressed, with particularly high levels in prostate, but is barely detectable in liver. It belongs to the ATP binding cassette (ABC) transporter family. MRP4 confers resistance to topotecan and acts as a double agent in protecting the brain from chemotherapy.


Catalog Number: (89359-558)
Supplier: Genetex
Description: L glutamate is the major excitatory neurotransmitter in the central nervous system. Glutamatergic neurotransmission is involved in most aspects of normal brain function and can be perturbed in many neuropathologic conditions. The metabotropic glutamate receptors are a family of G protein-coupled receptors that have been divided into 3 groups. Group II receptors include GRM3 and are linked to the inhibition of the cyclic AMP cascade.


Catalog Number: (89357-970)
Supplier: Genetex
Description: This gene encodes a member of the annexin family. Members of this calcium-dependent phospholipid-binding protein family play a role in the regulation of cellular growth and in signal transduction pathways. This protein functions in the inhibition of phopholipase A2 and cleavage of inositol 1,2-cyclic phosphate to form inositol 1-phosphate. This protein may also play a role in anti-coagulation. [provided by RefSeq]


Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
You must log in to order restricted items. We request that you provide the required business documentation to purchase this product for the first time.

To order chemicals, medical devices, or other restricted products please provide identification that includes your business name and shipping address via email CMD_NA@vwr.com or fax 484.881.5997 referencing your VWR account number . Acceptable forms of identification are:

  • issued document with your organization's Federal Tax ID Number
  • Government issued document with your organization's Resale Tax ID Number
  • Any other Government ID that includes the business name and address


VWR will not lift restrictions for residential shipping addresses.

-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is currently unavailable but limited stock may be available in our extended warehouse network. Please call 1-800-932-5000 and a VWR Customer Service Representative will help you.
273 - 1 of 1
no targeter for Bottom