You Searched For: Neodymium(III)+isopropoxide


2  results were found

Sort Results

List View Easy View
SearchResultCount:"2"
Description: Autocamtide-3 Derived Inhibitory Peptide(AC3-I); CaMKII Inhibitor, myristoylated, Purity: Greater than or equal to 95% (HPLC), Molecular weight: 1689.1, Sequence: Myr-KKALHRQEAVDAL, Storage: -20 degree C, Size: 1mg
Catalog Number: 103008-590
Supplier: Anaspec Inc


Description: [Cys(HiLyte* Fluor 647 C2 maleimide)]-Exendin-4, Sequence: C(HiLyteFluor 647 C2 maleimide)-HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2, Purity: By HPLC >/= 95%, HiLyte Fluor 647 labeled Extendin-4, Molecular Weight: 5486.3, Size: 50 ug
Catalog Number: 103007-522
Supplier: Anaspec Inc


Description: Protease-Activated Receptor-4, amide MW: 739.8, Sequence: trans-Cinnamoyl-YPGKF-NH2] This peptide is a selective PAR4 antagonist which inhibits thrombin- and PAR-4 agonist induced rat platelet aggregation, Store: -20 deg C, Size: 1mg
Catalog Number: 103010-030
Supplier: Anaspec Inc


Description: ClearPoint* beta-Amyloid (1-40), 13C, 15N - labeled at Arg & Lys, Human, Sequence: DAEF-R*-HDSGYEVHHQ-K*-LVFFAEDVGSN-K*-GAIIGLMVGGVV, Purity: By HPLC >/= 95%, All Arginine and Lysines have universally labeled, Molecular Weight: 4355.9, Size: 50 ug
Catalog Number: 103007-698
Supplier: Anaspec Inc


Description: NY-ESO-1 (87-111), Sequence: LLEFYLAMPFATPMEAELARRSLAQ, Purity: By HPLC greater than or equal to 95%,This is amino acids 81 to 111 fragment of the NY-ESO-1, expressed by many tumors of different histological types, Molecular Weight: 2869.4, Storage: -20 deg C, Size: 1 mg
Catalog Number: 103007-462
Supplier: Anaspec Inc


Description: Streptavidin, Recombinant, Streptavidin is a nonglycosylated tetrameric protein that binds biotin noncovalently and with high affinity, was expressed in E. Coli, It shows one major band about 56 kDa on SDS-PAGE, Apperance: Lyophilized powder, size: 500 mg
Catalog Number: 103010-564
Supplier: Anaspec Inc


Description: Histone H3 (21-44)-GK(Biotin), amide, Purity: Greater than or equal to 95% (HPLC), Molecular weight: 2932.5, Sequence: ATKAARKSAPSTGGVKKPHRYRPG-GK(Biotin)-NH2, Label: Biotin, peptide is Histone H3 (21-44) with an C-terminal glycine, Storage: -20 degree C, Size: 1mg
Catalog Number: 103008-388
Supplier: Anaspec Inc


Description: 6-TAMRA, SE, Synonym: 6-Carboxytetramethylrhodamine, succinimidyl ester; 6-TAMRA, NHS ester, purified single isomer, for nucleotide labeling and DNA sequencing, Molecular Weight: 527.53, Spectral Properties: Abs/Em = 547/573 nm, Solvent System: DMF or DMSO, Size: 5 mg
Catalog Number: 103010-852
Supplier: Anaspec Inc


Description: Beta-Amyloid (1-40), Purity: HPLC >/- 95%, Molecular Weight: 4742.4, Sequence: TAMRA-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV, label: TAMRA, Appearance: Lyophilized red powder, this is a fluorescent labeled B-Amyloid peptide, Abs/Em=551/567 nm, Size: 0.1 mg
Catalog Number: 103003-174
Supplier: Anaspec Inc


Description: SensoLyte* 490 HIV Protease Assay Kit *Fluorimetric*, Components: HIV-1 protease substrate 600 ul, EDANS 100 u
M DMSO solution, 20 ul, Pepstatin A 27.4 u
g powder, 2X Assay buffer 50 mL, Stop solution 30mL, DMSO 100 ul, DMSO 100 ul, storage: -20 deg C
Catalog Number: 103010-148
Supplier: Anaspec Inc


Description: Vitronectin (367-378), Purity: HPLC >/= 95%, MW: 1668, Sequence: [GKKQRFRHRNRKG] This heparin-binding peptide is derived from vitronectin (367-378). Monomer form in the blood and oligomer form in the extraceullular matrix. Biotin - labeled, Store: -20 deg C, Size: 5mg
Catalog Number: 103009-404
Supplier: Anaspec Inc


Description: Beta - Amyloid (1 - 15) - Lys16(HiLyte* Fluor 488), Human, B-Amyloid peptide, residues 1 to 16 labeled with HiLyte* Fluor 488 on the Lys16, Abs/Em =501/527, Molecular Weight: 2311.4, Storage: -20 deg C, Size: 0.5 mg
Catalog Number: 103007-136
Supplier: Anaspec Inc


Description: Suc-LLVY-AMC, fluorogenic substrate, Sequence: Suc-LLVY-AMC, Purity: By HPLC >/= 95%, used as a fluorogenic substrate for 20S proteasome, calpains and other chymotrypsin-like proteases, Molecular Weight: 763.9, Storage: -20 deg C, Size: 5 mg
Catalog Number: 103007-798
Supplier: Anaspec Inc


Description: Cecropin A, Sequence: KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK - NH2, Purity: HPLC greater than or equal to 95%, Molecular Weight: 4003.8, Apperance: Lyophilized white powder,Peptide Reconstitution: Cecropin A peptide is freely soluble in H2O, Storage: -20 deg C, Size: 0.5 mg
Catalog Number: 102999-782
Supplier: Anaspec Inc


Description: Transdermal Peptide, Sequence: ACSSSPSKHCG, short synthetic peptide facilitates efficient transdermal protein drug delivery through intact skin and enable macromolecular drugs to reach systemic circulation, Molecular Weight: 1063.2, Storage: -20 deg C, Size: 1 mg
Catalog Number: 103007-172
Supplier: Anaspec Inc


Description: HiLyte* Fluor 594 hydrazide-TFA Salt, alternative to Alexa Fluor* 594 and DyLight Fluor* 594, Spectral characteristics similar to Texas Red, MW: 879.93, Spectral Properties: Abs/Em = 593/616 nm, Solvent System: DMF or DMSO, Storage: -20 deg C, Size: 1 mg
Catalog Number: 103010-962
Supplier: Anaspec Inc


1 - 2 of 2